KEGG   Ethanoligenens harbinense: Ethha_2540Help
Entry
Ethha_2540        CDS       T01384                                 

Definition
flagellar protein FliS
Orthology
K02422  
flagellar protein FliS
Organism
eha  Ethanoligenens harbinense
Pathway
Flagellar assembly
Brite
KEGG Orthology (KO) [BR:eha00001]
 Cellular Processes
  Cell motility
   02040 Flagellar assembly
    Ethha_2540
Bacterial motility proteins [BR:eha02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    Ethha_2540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2722321..2722701)
Genome map
AA seq 126 aa AA seqDB search
MTFNPYQYYKNQALDTSSKYELVGRCYGDAAASIKRAQLYLDEKNFEQANSSILKAQKIL
AGLDGALDMQYEIAGQLHTLYGYMQKKLFKANLSGDKTALKTVAGMLDELRDTWTQAVKN
YKKIQA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgacgttcaatccatatcagtattataagaaccaggcgctggacaccagcagcaaatat
gagctggtgggccgttgctatggggatgcggccgcttccatcaagcgtgcgcagctctat
ctcgacgaaaagaactttgaacaggcgaacagcagcattctgaaagcccagaagatcctg
gccgggctggacggcgcgctggatatgcagtacgaaatcgccggacaactgcacacctta
tacggctacatgcagaaaaaactgtttaaggccaacctctccggcgacaagacggcgctg
aaaaccgtggccggtatgctggacgaactgcgggacacatggacgcaggccgttaaaaat
tacaagaagatacaggcatag

DBGET integrated database retrieval system