KEGG   Ethanoligenens harbinense: Ethha_2540Help
Entry
Ethha_2540        CDS       T01384                                 

Definition
flagellar protein FliS
Orthology
K02422  
flagellar protein FliS
Organism
eha  Ethanoligenens harbinense
Pathway
Flagellar assembly
Class
Cellular Processes; Cell motility; Flagellar assembly [PATH:eha02040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2722321..2722701)
Genome map
AA seq 126 aa AA seqDB search
MTFNPYQYYKNQALDTSSKYELVGRCYGDAAASIKRAQLYLDEKNFEQANSSILKAQKIL
AGLDGALDMQYEIAGQLHTLYGYMQKKLFKANLSGDKTALKTVAGMLDELRDTWTQAVKN
YKKIQA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgacgttcaatccatatcagtattataagaaccaggcgctggacaccagcagcaaatat
gagctggtgggccgttgctatggggatgcggccgcttccatcaagcgtgcgcagctctat
ctcgacgaaaagaactttgaacaggcgaacagcagcattctgaaagcccagaagatcctg
gccgggctggacggcgcgctggatatgcagtacgaaatcgccggacaactgcacacctta
tacggctacatgcagaaaaaactgtttaaggccaacctctccggcgacaagacggcgctg
aaaaccgtggccggtatgctggacgaactgcgggacacatggacgcaggccgttaaaaat
tacaagaagatacaggcatag

DBGET integrated database retrieval system