KEGG   Ethanoligenens harbinense: Ethha_2590Help
Entry
Ethha_2590        CDS       T01384                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
eha  Ethanoligenens harbinense
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eha00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ethha_2590
Enzymes [BR:eha01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Ethha_2590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2772336..2773898)
Genome map
AA seq 520 aa AA seqDB search
MRLKKQKPLARGAGILLPVSSLPSPYGIGTFGRAAFEFVDFLKKAGQTYWQVLPLGPTSY
GDSPYQSFSAFAGNPYFIDPDILIEEGLLTDAEAETPDWGGVPSQVDYGKQFEARFALLK
QAYVRSRHASTEAYRLFCEENEAWLPDYSAYMAIKAQFGNRSWVEWPDDIRLRRPEAVAA
CVEDLQQEIGFWSFCQFKFYEQWNRLKAYANKNGVQIIGDIPIYVSMDSADVWVNSRFFQ
LDADRRPVAVSGVPPDMFSATGQLWGNPLYDWDVMGRDRFAWWKQRMCASAKLYDVIRID
HFIGIVRYYSIPAKDGTAMNGVWKAGPGKALLAAFGPVLGAARVIAEDLGAVTPAVRRVK
QAAGYPGMKLMEFGFDDGTENPNLPHNFENNCIVYGGTHDNETLVGFFKHQKRKELAFAK
TYLNVRRRGELPWALVRAAYASVADTVIFQMQDFLELDNGARMNCPSTIGGNWMWRVLPG
QLSDELADRIRHLAETYARFKPPEPQKHPGSSVPNKCEEQ
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgcggctaaaaaaacaaaaaccgcttgcgcgcggtgcgggcatcctgctgccggtgagc
agcctgccgtcgccctatggcatcggcacgttcgggcgcgcggcgttcgagtttgtggat
tttctcaaaaaagcggggcagacctactggcaggtgctgccactcggccccaccagctat
ggagacagcccctaccagagcttttcggcgtttgcgggcaacccgtatttcatcgacccg
gatatcctgatagaggaaggactgctcaccgacgcggaggcggaaacgcccgactggggc
ggcgttccttcccaggtcgattacggcaagcagttcgaggcacggttcgctttgctcaaa
caggcctatgtacgcagccggcacgcttccacggaagcctaccgcctgttttgcgaggaa
aacgaggcatggctgccggattacagcgcctatatggccatcaaggcgcagtttggcaac
cggtcgtgggtggaatggccggatgatatccgcctgcgccgcccggaagcggtggcggcc
tgtgtcgaagacctgcaacaggagatcgggttctggtccttctgccagttcaaattttat
gaacaatggaaccggctcaaagcgtacgcgaataaaaacggcgtacagatcatcggggat
atccccatctatgtatcgatggacagcgccgacgtgtgggtgaacagccgcttcttccaa
ctggatgcggaccgccgtccggtcgcggtgtcgggtgttccgccggatatgttttccgcc
accggccagctctggggcaacccgctgtatgactgggacgtgatgggacgggacaggttc
gcctggtggaagcagaggatgtgcgcctctgcgaagctctatgatgttatccgcatcgac
catttcatcgggatcgtgcgctactattccatcccggccaaggacggcaccgccatgaac
ggcgtctggaaggccggcccgggcaaggcgctgctcgcggcgtttggcccggtgctggga
gccgccagggtgattgccgaagacctgggggcggtcacaccggccgtgcgccgtgtgaag
caggccgcaggctatccgggcatgaagctgatggagttcgggtttgacgacgggacggaa
aaccccaatctgccgcacaattttgaaaacaactgcatcgtctacggtggcacgcacgac
aatgaaacgctcgtcggctttttcaaacaccaaaaaagaaaagaactcgcgttcgccaaa
acgtatctcaatgtccggcggcgcggggagctgccgtgggcgctcgtccgtgcggcgtac
gccagcgtggcggacaccgtcatcttccagatgcaggacttcctggagctggacaatggc
gcgcgcatgaattgcccgtccaccataggcggcaactggatgtggcgggtgctgccgggg
cagctttcggatgaactggcagaccgtatacgccatctggccgaaacatatgcccgcttc
aagcctccggaaccgcagaagcatcccggatcgtccgttccaaacaaatgcgaggagcag
taa

DBGET integrated database retrieval system