KEGG   Encephalitozoon hellem: EHEL_010040Help
Entry
EHEL_010040       CDS       T02287                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ehe  Encephalitozoon hellem
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EHEL_010040
   00670 One carbon pool by folate
    EHEL_010040
Enzymes [BR:ehe01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     EHEL_010040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:8586..9200
Genome map
AA seq 204 aa AA seqDB search
MFALIVAFAKNKGIGKNNRLPWPPLRTDMSWFRTLSQSVPLITSDRIDLSPSSSNAVVMG
RKTWDSIPPRFQPLPNRTNIVLSRRPGISTENTLFISAFGDIEHLRIPSSSMVFVIGGHD
IYSLAIQSGRAHIIFATEISESLECDVFFPRIDWDAYERRDITREVSGLVGKDLADAFYN
TEANAFTENGITFKMFIYIKHGAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccttaattgttgcctttgccaagaacaaggggataggaaagaacaacaggctg
ccctggcctcctctaagaacagacatgtcctggttcagaaccctttcccagagtgttccc
ctcattacttcagaccgcatcgatctttctccatcctcgtcgaatgccgtagtgatgggg
aggaagacatgggactcgattcctcccaggttccagccccttccgaaccgcacgaatatt
gttctatcaagaaggccggggatcagcacagaaaacacgctcttcatctcagcatttgga
gacatcgagcacttgaggattccttcgtcctcgatggtgtttgtgataggaggacacgac
atctacagccttgcgatccagagcgggagggcccatattatatttgctaccgaaatctct
gagtctcttgaatgcgatgtgttctttccccgcatagactgggacgcctatgaaagaaga
gacattacacgtgaggtctcgggactcgttggcaaagaccttgcagatgccttctacaac
acagaggcgaatgcatttacagagaacggaataaccttcaagatgtttatttatattaaa
cacggggccctatag

DBGET integrated database retrieval system