KEGG   Encephalitozoon hellem: EHEL_011350Help
Entry
EHEL_011350       CDS       T02287                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ehe  Encephalitozoon hellem
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ehe00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ehe00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(152385..152999)
Genome map
AA seq 204 aa AA seqDB search
MFALIVAFAKNKGIGKNNRLPWPPLRTDMSWFRTLSQSVPLITSDRIDLSPSSSNAVVMG
RKTWDSIPPRFQPLPNRTNIVLSRRPGISTENTLFISAFGDIEHLRIPSSSMVFVIGGHD
IYSLAIQSGRAHIIFATEISESLECDVFFPRIDWDAYERRDITREVSGLVGKDLADAFYN
TEANAFTENGITFKMFIYIKHGAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccttaattgttgcctttgccaagaacaaggggataggaaagaacaacaggctg
ccctggcctcctctaagaacagacatgtcctggttcagaaccctttcccagagtgttccc
ctcattacttcagaccgcatcgatctttctccatcctcgtcgaatgccgtagtgatgggg
aggaagacatgggactcgattcctcccaggttccagccccttccgaaccgcacgaatatt
gttctatcaagaaggccggggatcagcacagaaaacacgctcttcatctcagcatttgga
gacatcgagcacttgaggattccttcgtcctcgatggtgtttgtgataggaggacacgac
atctacagccttgcgatccagagcgggagggcccatattatatttgctaccgaaatctct
gagtctcttgaatgcgatgtgttctttccccgcatagactgggacgcctatgaaagaaga
gacattacacgtgaggtctcgggactcgttggcaaagaccttgcagatgccttctacaac
acagaggcgaatgcatttacagagaacggaataaccttcaagatgtttatttatattaaa
cacggggccctatag

DBGET integrated database retrieval system