KEGG   Encephalitozoon hellem: EHEL_020430Help
Entry
EHEL_020430       CDS       T02287                                 

Definition
mitogen-activated protein kinase
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
ehe  Encephalitozoon hellem
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:ehe00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    EHEL_020430
Enzymes [BR:ehe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     EHEL_020430
Protein kinases [BR:ehe01001]
 Serine/threonine protein kinases: Other group
  TTK family
   EHEL_020430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:50957..52711
Genome map
AA seq 584 aa AA seqDB search
MEGIFNSKDLYEYLEEQKESGISKTRKISLYYKATSKSVGDDEYSLRIWLDYIWLLMDGT
KDMTEARETFKMIKMRFCKFYNYWEAYIRFEIEAGNENLSKVLQHSVDFVRVKEFGEKKR
VLEYLECVMSCVLNGQDLSVFSKCLKGSHTTDFQLSSHFESKIEDYRSKILKKEGRESED
ISGSGKGFLPRGDGVYPTFGESKENLCNRNKADGNGSTLLSSFDPKPKGYFSTAFGTIPV
KFEKEDYSEGITTEINTALGRTSPGESNSSPRSGMMRAREKIAVKGREVEILKQIGKGGS
SKVYKVLLGNNIYALKRVELVGDEKMLNSYINEINLLYKFKGAPEIVEIIDHEIGEDYLH
ILLEYGETDLSKIIRKGGLSMNFIKDVWEQMLLIVKRVHMERIIHCDLKPANFLFVKGRV
KLIDFGISKVIRNDTTSILSEEQCGTVNYMSPEAVTQNKSKVARSSDIWSLGCILYEMAH
SKPPLHEYPNLIQKIQKLQEYSEFTYSSKNKLAVMVMKECLVRDPKKRPTIDSLLNHRFL
TGEICIESLKELVGKVLEISGKDESDSTYIDKITEQLCDAHGWH
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaatcttcaacagcaaggatctttacgagtaccttgaggagcagaaagagtcg
ggaatatcgaagaccaggaaaatatctctgtactacaaagcaacatcgaaaagcgtgggg
gatgacgagtactcgctaaggatatggctagactatatctggctacttatggatggaaca
aaagatatgacagaggccagagaaacattcaagatgataaagatgaggttctgtaagttt
tacaattactgggaagcatacattcggtttgagattgaggctggaaacgaaaatctttcc
aaagtcctgcagcatagcgttgactttgtcagggtgaaggagtttggtgaaaagaagagg
gtactagagtacctggagtgtgtaatgtcctgcgtcctgaacgggcaagacctgtctgtg
ttttcaaagtgccttaaggggagccacacaacagattttcaactttccagccattttgaa
tccaagatagaagactacagaagcaagattctgaagaaagaaggtagggaatccgaggat
atatctggcagcggaaaaggttttctgccccgaggtgacggagtctacccgacatttgga
gaatccaaggagaatctgtgcaatagaaacaaagccgacggtaacggttctactctgttg
tctagctttgacccgaagcctaagggctatttcagcacggccttcggaacaatacctgtc
aaattcgagaaggaagactattctgagggaataaccacggaaataaacacagccttggga
agaacaagccctggggaaagtaactcatctccaaggtctgggatgatgagggctagagag
aagatagctgtaaagggaagagaggtcgaaatactcaagcaaataggaaaaggaggaagc
agcaaggtgtataaggttcttcttggaaataacatatatgccttaaaaagagttgaacta
gttggagacgagaagatgcttaattcatacatcaatgaaataaatctgctgtataaattc
aaaggggcgcccgagatagttgaaattatagatcatgagataggtgaggactacttgcac
atcttgctggaatacggagaaaccgatctgtcgaagatcataaggaaaggagggctaagt
atgaacttcatcaaggatgtatgggagcagatgcttctaatagtgaagagagttcacatg
gaaagaataatccactgtgatctcaagccagcaaacttcctgtttgttaaagggcgtgtg
aagctcatagactttggaatatcgaaggttataagaaatgacacaacaagcattctttct
gaggagcaatgcggaacagtgaactatatgtctcctgaggctgttacccagaacaagtcc
aaggttgcccgtagctcagatatttggtctctgggatgcatactctacgaaatggcccat
tcaaagcctccgctgcacgagtatcctaacctgatccaaaagattcagaagctgcaggag
tattctgagtttacatattcaagcaagaacaagcttgccgtgatggtcatgaaggaatgc
ttggtcagagacccaaagaagaggccaaccatagatagccttctcaatcacagatttctc
acaggagaaatatgcatagaatccctcaaggaattagttggaaaggtccttgagattagt
ggaaaggacgagtccgattctacatacatcgataagataaccgagcagctttgcgatgca
catggatggcattag

DBGET integrated database retrieval system