KEGG   Encephalitozoon hellem: EHEL_021230Help
Entry
EHEL_021230       CDS       T02287                                 

Definition
dolichyl-phosphate-mannose-protein mannosyltransferase
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ehe  Encephalitozoon hellem
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:ehe00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(145977..147986)
Genome map
AA seq 669 aa AA seqDB search
MPKVKYLDVSTTLLIFALSVIIKTYKIENGNFVIWDEAHFGKFSEKYLSRKFYFDVHPPL
GKILTSLGGYLFNQPLDFEFKSGEKFPQGFDYSGMRRFHSVIASFTPVFGYLMLREMGYS
YRRRAVLSLMFIFENGFTSIGRLILLDSHLLTFTAAVAYFMTRMYFRSKKRVDLPSIFFL
GITLGCVMSIKWIGFLTMSLVGTFTIYRLWCNVTSKESILAFAKLFLVKAFFLIGIPSFL
YVFLFYIHFAIVNRSSSDDGHMSSLFQATLKGSDISNNRKYPLFGTKITIKASKVGGGYL
HSHDHKYPDGENNQVTIYHHKDENNGWVFQKVTDDLEDADFIESGDTVVLLHMETRKYLD
VPGNHSLISSGLRAESSGSHLSDTNLFKVEIVNDSLKKEDRMKTLTTKFRLLNIKHNCYL
RPSSKKYPSWGFEQGEVVCTTKKDKASLWNVEENVTNKLDEERNPIYKEIAEYPFIKKFI
EHNKTMFITNASFVQDEDLEPERIVSRPHEWFTLRRGLRMTAWDGQNEKFYMFGNPLIWY
SSGICIILSPLILLSRVISRKRRGKPLTFLKSEGYMVFLSCCGWFLHYIPFFFVKRVLYF
HHYYPALFFALFSLCYIMKFVKFRFVVVFMSAVIISFFLYSSLTYGFKEETSFLRRISMV
PTWDFIEKG
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaagtgaagtatctcgatgtgtccacaaccctcctgatatttgcactgagtgta
atcataaaaacctacaagatagaaaacgggaactttgttatttgggatgaggcacacttc
ggcaaattttcggaaaaatacttgtctaggaagttctacttcgacgttcatcctcctcta
gggaagatattgacctcgcttggaggatatctcttcaaccagccattggactttgagttc
aaatctggagagaaatttccccaagggtttgattattcaggaatgcgaaggttccactca
gtcatagcatcttttacgcctgtttttggatatctcatgctcagggagatgggatattca
tataggcgtagggccgttctgtctctaatgttcatatttgagaatggattcacatccatc
ggaaggctcatacttttggattcccatctcttgacatttacagcagccgttgcatacttt
atgacaagaatgtattttagatcgaagaaaagagtagacctcccctccattttttttctg
ggcataactctaggctgtgttatgagcatcaaatggataggttttttgacaatgagcctg
gttggaacatttaccatatatcgtctatggtgcaacgtaacttctaaggaaagcattctt
gcctttgcgaagctgttccttgtaaaagcattcttcctaattggcattccctcatttttg
tatgtttttctgttctacattcattttgcgatagttaatagaagtagcagtgatgatggg
catatgagctcacttttccaggccacactcaagggaagcgacatcagcaataatagaaag
tacccgctatttggaacaaagataaccatcaaagcatccaaagtaggtggaggatatctt
cattcccacgaccataaatatccagatggagaaaacaaccaggtaaccatctatcaccac
aaagacgagaataacggatgggtattccagaaggtgacggacgaccttgaagatgcagac
tttatagagtctggtgataccgtggtcctattgcatatggaaacaagaaagtacttggat
gtccctggcaatcactctcttatctcaagcggattgagagcagagtcttctgggagccat
ctctccgatacaaacttgtttaaggtcgaaatagtgaacgactctctaaagaaagaagac
cgaatgaagacccttacaaccaagtttaggttgttaaacatcaaacacaattgctacctt
aggccttcatcgaagaagtatccctcttgggggtttgagcagggagaggttgtctgtact
acgaaaaaagacaaggcctccctttggaatgtcgaagaaaacgttactaacaagcttgat
gaggaaagaaaccctatatacaaagagattgcagaatacccgtttatcaaaaagttcata
gaacacaacaagaccatgtttatcacaaatgcctccttcgtccaggatgaggaccttgag
ccagaaagaatagtttcaaggccacatgagtggtttaccctcagacgagggctgagaatg
actgcatgggacgggcagaatgagaagttctatatgtttggaaacccgcttatatggtac
tcttcaggtatctgcataatcctttctccccttattcttctttctagggtcatcagccgc
aagagaaggggaaagccactgaccttcctaaagagtgagggttatatggtctttttgtcg
tgctgtggatggtttctgcactatattccattcttctttgtcaaaagagtactgtatttc
caccactactaccccgctttgtttttcgcattattttcattgtgctatattatgaagttc
gttaagttcaggtttgttgtcgtgttcatgtctgcggtgattatatcctttttcctatat
tcaagtctgacatacgggtttaaggaagaaacatcatttcttaggagaatcagcatggtt
cctacctgggatttcatagagaaggggtga

DBGET integrated database retrieval system