KEGG   Encephalitozoon hellem: EHEL_030160Help
Entry
EHEL_030160       CDS       T02287                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ehe  Encephalitozoon hellem
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ehe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EHEL_030160
   00052 Galactose metabolism
    EHEL_030160
   00500 Starch and sucrose metabolism
    EHEL_030160
   00520 Amino sugar and nucleotide sugar metabolism
    EHEL_030160
Enzymes [BR:ehe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EHEL_030160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III:complement(19975..21453)
Genome map
AA seq 492 aa AA seqDB search
MQDNKNKEATLSGDEDKDVHRFLDEFDDKCTCKLLKEMKETLEKMKKNHPNPGDLDEFHR
LFERYLRTRNEKIVWETIRSPKDRIIQYDEIPGPTEKSKELLKKLAILKLNGGLGTTMGC
VGPKSAISVKDGKNFIDLIVKQVRYLNSKYDIDVPLILMNSFNTEGMTDKIIFRYDGIRK
FSQSKFPRISSETLLPVSSEYGDKGMYPPGHGDLFYSLKNSGMLEELLNDGYEYLFVSNI
DNLASTVDLKLLEYFATNDLGFLMEVTDKTRADVKGGTLIEYKGALRLLEIAQVPSSKKS
EFTSFKKFTIFNTNNIWINLKDMKKKLEKGFFDLDIIENKKTLGDETVIQLETAIGSAIK
YFPNSCGVVVPRSRFLPVKTCSDLFLVESNLFVEKNGTLQLHPSRVPKTCPAIRLIGKNF
SKIENYEKCFKGIPDILELDILTVSGNVIFGKNVVLKGTVIILADEKSKICIPDGSVLDD
SILYGHLPILDH
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgcaagataataagaacaaagaggccacactctccggtgatgaggacaaagatgtccat
agattcttagatgagttcgacgacaagtgcacctgcaagcttttgaaggaaatgaaagaa
acattagaaaagatgaagaagaatcatccaaatcctggggacttagatgaattccacaga
ttatttgaaagatatctcagaacaagaaatgagaagatagtatgggaaacaattaggtcg
ccaaaagataggattattcaatacgatgaaataccagggccaacagaaaaatccaaagaa
ctgttgaagaagctagccatactaaaacttaatggcgggcttggaacaacgatgggatgt
gtagggccaaagagtgccatatctgttaaagatggtaagaatttcatagatctgattgtt
aagcaagtcagatacttgaattcaaagtacgacatagatgttccgttgatactgatgaac
tcgttcaataccgaagggatgacagacaagatcatatttagatatgatggaatcaggaag
ttttcccaaagcaagtttccaagaatctcgtcggaaacattactccctgtctcatctgaa
tacggagataagggaatgtatccaccagggcatggagatttgttttactcattaaagaat
agtgggatgctagaggagcttctgaatgatgggtatgaataccttttcgtgtctaacatt
gacaacctggcttccacagtagacctgaagcttctggagtattttgctaccaatgatctg
ggatttcttatggaggtgactgataagacacgtgcagatgtcaaaggaggaacccttata
gaatataagggggcattgagacttcttgaaatagcccaggtcccatcaagcaagaaatcg
gagtttacaagcttcaagaaattcacaatattcaatacgaacaatatttggataaattta
aaggatatgaagaaaaagctagaaaaaggcttttttgatttggatattatcgagaacaag
aagacattaggagatgaaacggttattcagttggagacagctatagggtctgcaatcaaa
tacttccccaactcttgtggtgtcgttgttccgcgatctagattcttacctgtgaagacc
tgctctgatctatttcttgttgaaagcaacctatttgttgagaagaatgggacgcttcag
cttcatccatcaagagtcccgaagacgtgtccggcaatcagacttattggaaagaatttc
tcaaaaatagaaaactatgagaaatgtttcaaagggattccagatattcttgagttggac
atcctaacagtaagtggcaacgttatattcggcaagaatgttgttcttaagggaaccgtt
atcatactggcggatgagaaaagtaagatatgcattcctgatgggtctgtgcttgacgac
agcatcctatatggtcatcttccaattttagaccattaa

DBGET integrated database retrieval system