KEGG   Encephalitozoon hellem: EHEL_030160Help
Entry
EHEL_030160       CDS       T02287                                 

Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ehe  Encephalitozoon hellem
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ehe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EHEL_030160
   00052 Galactose metabolism
    EHEL_030160
   00500 Starch and sucrose metabolism
    EHEL_030160
   00520 Amino sugar and nucleotide sugar metabolism
    EHEL_030160
Enzymes [BR:ehe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EHEL_030160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III:complement(19975..21453)
Genome map
AA seq 492 aa AA seqDB search
MQDNKNKEATLSGDEDKDVHRFLDEFDDKCTCKLLKEMKETLEKMKKNHPNPGDLDEFHR
LFERYLRTRNEKIVWETIRSPKDRIIQYDEIPGPTEKSKELLKKLAILKLNGGLGTTMGC
VGPKSAISVKDGKNFIDLIVKQVRYLNSKYDIDVPLILMNSFNTEGMTDKIIFRYDGIRK
FSQSKFPRISSETLLPVSSEYGDKGMYPPGHGDLFYSLKNSGMLEELLNDGYEYLFVSNI
DNLASTVDLKLLEYFATNDLGFLMEVTDKTRADVKGGTLIEYKGALRLLEIAQVPSSKKS
EFTSFKKFTIFNTNNIWINLKDMKKKLEKGFFDLDIIENKKTLGDETVIQLETAIGSAIK
YFPNSCGVVVPRSRFLPVKTCSDLFLVESNLFVEKNGTLQLHPSRVPKTCPAIRLIGKNF
SKIENYEKCFKGIPDILELDILTVSGNVIFGKNVVLKGTVIILADEKSKICIPDGSVLDD
SILYGHLPILDH
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgcaagataataagaacaaagaggccacactctccggtgatgaggacaaagatgtccat
agattcttagatgagttcgacgacaagtgcacctgcaagcttttgaaggaaatgaaagaa
acattagaaaagatgaagaagaatcatccaaatcctggggacttagatgaattccacaga
ttatttgaaagatatctcagaacaagaaatgagaagatagtatgggaaacaattaggtcg
ccaaaagataggattattcaatacgatgaaataccagggccaacagaaaaatccaaagaa
ctgttgaagaagctagccatactaaaacttaatggcgggcttggaacaacgatgggatgt
gtagggccaaagagtgccatatctgttaaagatggtaagaatttcatagatctgattgtt
aagcaagtcagatacttgaattcaaagtacgacatagatgttccgttgatactgatgaac
tcgttcaataccgaagggatgacagacaagatcatatttagatatgatggaatcaggaag
ttttcccaaagcaagtttccaagaatctcgtcggaaacattactccctgtctcatctgaa
tacggagataagggaatgtatccaccagggcatggagatttgttttactcattaaagaat
agtgggatgctagaggagcttctgaatgatgggtatgaataccttttcgtgtctaacatt
gacaacctggcttccacagtagacctgaagcttctggagtattttgctaccaatgatctg
ggatttcttatggaggtgactgataagacacgtgcagatgtcaaaggaggaacccttata
gaatataagggggcattgagacttcttgaaatagcccaggtcccatcaagcaagaaatcg
gagtttacaagcttcaagaaattcacaatattcaatacgaacaatatttggataaattta
aaggatatgaagaaaaagctagaaaaaggcttttttgatttggatattatcgagaacaag
aagacattaggagatgaaacggttattcagttggagacagctatagggtctgcaatcaaa
tacttccccaactcttgtggtgtcgttgttccgcgatctagattcttacctgtgaagacc
tgctctgatctatttcttgttgaaagcaacctatttgttgagaagaatgggacgcttcag
cttcatccatcaagagtcccgaagacgtgtccggcaatcagacttattggaaagaatttc
tcaaaaatagaaaactatgagaaatgtttcaaagggattccagatattcttgagttggac
atcctaacagtaagtggcaacgttatattcggcaagaatgttgttcttaagggaaccgtt
atcatactggcggatgagaaaagtaagatatgcattcctgatgggtctgtgcttgacgac
agcatcctatatggtcatcttccaattttagaccattaa

DBGET integrated database retrieval system