KEGG   Encephalitozoon hellem: EHEL_030490Help
Entry
EHEL_030490       CDS       T02287                                 

Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
ehe  Encephalitozoon hellem
Brite
Enzymes [BR:ehe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     EHEL_030490
Peptidases [BR:ehe01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   EHEL_030490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III:62674..65475
Genome map
AA seq 933 aa AA seqDB search
MDEGWKVKRPPNGTKAESKLFSAQGHKWKLVLSNRGGRIYLALEYQGGSYHDVLTTFCFD
INGKRHEYQYQFSMFNTDIGIYVEDKDSYVVKVDISVRSGYYNSRKETGHVGLRNLGATC
YVNSLMQALFNIAKFRNDVFGLEPSGRVLLLQKLFKEMQVEEHPVDTTDFVVNNIWVDDV
HVHQDIHEFSKVFFDSLEKDSKRKDFIEDLIQGELTTYIDGKCGCVRKIKEKFQDIQVEI
RDFLNNKLSSNLHESLKRYVEAEVLDGNNKYNCEKHGFVDAKKGVLFRSLPPVMFVLLKR
FNVDFETGNGYKVNDYFEFPSSIDMSPFMEKDDGEEKQSDETYDLYSVIVHRGDHDEGHF
YAYLKIGGRWLKFNDTVVTEAGEMEAMEHNFGGKHPYKDKIRDYSGYYLIYLRRSMSDSL
LNMKVTIPGRIEEILKKKQSKVPIKCIKIDNIRNYRGVGFYNVSSYDYPLSGYTEFIIKE
GDSIKLLKNNIEKHLNTRRFLYLFECTRMEDTKKMDTAERPSKRIKEDAHGSMEPETGKG
EDISRAIEYVRLSHQRNVSLVSDGFVNTDADYFIYACYPEVDFKRNRLIFLKVFSNMPWC
EDTLPTSLRLCACIHMEGTIKDNMSVIIEKTGLEDVVVFREFDFSSALDPSTDVSSLPQG
DVLISVRREDVLEFLDFISDFYRRLCVNVSCGPHNFTVFVRRGLTSTELEGKIRRFVGSK
EIFLKRGEAVSDSSGFRTAVEDFTQSDAESDARESLQAKNTVTCTISPEYQVVYLGFCNK
EMDYNSVPHLHIFVTKIGCTSLELIKNVLVSHFICLNPVRGHSLKALRIVDTVRDTLYLK
GFGMSEEFTANGMCVIQPFVKRAIKTAYYSGMYKIIGFPFFLQTDAESVAEFRKKYKLFG
KMVMFDGKSYTDLELDWPMSKFNDECFLLIERT
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atggatgagggttggaaagtaaaaaggccacctaacgggacgaaggcggagtccaagctg
ttttctgcacaaggacacaagtggaagttagttctatcgaacaggggcgggaggatatat
ttggcattggaataccaagggggatcgtaccacgacgtcctgacaacattttgttttgat
attaatgggaagaggcacgagtatcagtatcagttttcgatgttcaataccgatattgga
atttatgttgaagacaaggacagctatgtggtcaaggttgatataagcgtgaggagtgga
tactacaactcaagaaaggaaacggggcatgtagggcttcggaatcttggagcaacttgc
tatgtaaactccctaatgcaggccttgttcaacatagcaaagttcaggaacgacgtcttt
gggctagagcctagcggaagggtgctgctcctccagaagctattcaaggaaatgcaggtg
gaagagcatcccgtggacacaacagactttgttgtgaacaacatatgggtggatgatgtt
catgtccaccaggacattcacgagttctcgaaggttttttttgattctctggagaaggac
agcaagagaaaggactttatagaggatctaatccagggagagttgacgacctacatagat
ggaaagtgcggatgtgtccggaaaataaaggagaagttccaggatatccaggtggagatc
agggacttcctcaacaacaaactgtcatcaaatctccacgagtctttgaagaggtatgtg
gaggcggaggtgcttgatggaaataacaaatacaactgtgaaaagcatgggtttgtggat
gcaaagaagggggtgctgttcaggtctcttcccccggtgatgtttgttcttctgaagagg
ttcaatgttgactttgagacaggaaatggctataaagtgaacgactactttgagtttccc
tcctcaattgacatgtcaccgtttatggagaaggacgatggcgaggagaagcagtctgac
gagacatatgatctctattctgtgattgtgcacagaggagaccatgacgaaggacacttt
tatgcttacttgaagattggtggaagatggctcaagttcaacgacacggttgtgacagag
gctggggagatggaggccatggagcataattttggaggaaaacatccttacaaggacaag
ataagggattactcgggatactatctgatttatctcagaagaagtatgtctgacagcctg
ttgaatatgaaggttactattcctggaagaatagaggagatactaaaaaagaagcaaagc
aaggtcccgatcaagtgtataaaaatagataacatcaggaactataggggggttggattc
tacaatgtcagctcatacgactatcccctgagtggatatactgagtttattataaaagag
ggagatagcattaagcttctgaaaaataacatcgaaaagcaccttaacactcggagattc
ttgtatctgtttgaatgcaccaggatggaagacaccaagaagatggatacagcagaaagg
ccaagcaagaggattaaagaggatgcccatgggtcgatggagcctgagactgggaaggga
gaagatatttccagggccatcgagtatgtaagactcagccatcagaggaacgtgagcctt
gtaagcgacgggtttgtcaacactgatgctgactacttcatttatgcatgctatccagag
gttgactttaagagaaacaggcttatctttctgaaggtttttagtaatatgccctggtgc
gaagacacactacccacctctttaaggctttgtgcatgtatacatatggaaggaacgatc
aaggacaatatgagcgttatcattgagaaaacagggcttgaagatgttgtggtgttcagg
gagtttgatttctcgtctgcattggacccgtctactgatgtttctagccttccacaagga
gacgtcttgattagcgttcgaagggaggatgtcctggagttccttgactttataagcgat
ttctatagaagactgtgtgtgaatgtttcctgcggccctcacaacttcactgtgtttgtg
agaaggggattgacgagcacagagcttgagggcaaaatccggcggtttgtagggtctaag
gaaatcttcctgaagagaggagaggctgtttctgatagctcaggattcaggacggcagtg
gaagacttcacacagtcggatgcggagtcggatgcccgtgaaagcctgcaagcaaagaac
actgtgacttgcactatcagtccggagtatcaggtggtttatctggggttctgcaacaaa
gagatggactacaactctgttcctcatcttcacatttttgtaaccaagatcgggtgcacc
tccctggagctaatcaagaacgttcttgtgtctcattttatatgcctcaatcctgtgcgg
gggcattctctgaaggccctgaggatagtagacactgttagagatacgctgtatcttaag
gggtttgggatgtccgaggaatttaccgccaatgggatgtgtgttatccagccctttgta
aagagggctatcaagacagcatactacagtggaatgtacaagataatagggtttccattc
ttcttgcaaacagatgcagagagcgttgctgagttcagaaagaaatacaaactgtttggg
aagatggttatgtttgacggaaagagctatacagacttagagctcgactggcctatgagc
aagttcaatgacgaatgcttcctgttgattgaaagaacgtag

DBGET integrated database retrieval system