KEGG   Encephalitozoon hellem: EHEL_030570Help
Entry
EHEL_030570       CDS       T02287                                 

Definition
isopeptidase T
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
ehe  Encephalitozoon hellem
Brite
Enzymes [BR:ehe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     EHEL_030570
Peptidases [BR:ehe01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   EHEL_030570
Exosome [BR:ehe04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   EHEL_030570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III:71090..72817
Genome map
AA seq 575 aa AA seqDB search
MRLPDLSRFREKCCYCYSDVEEGISVCGCGLSFCKGHVDIHLGKAECHVVFEIKEVGDDL
GIEIKNTMLKQEEIEELRIRMEALVKPGNEDERIISKDEEVGCAHGCPEGPCSIELGDLE
RLSCKLCDVRARLWACFSCGYVGCGRVQYGVEGNGHARAHYEQTQHNVFVLVPSLLKESC
EVFCYLCDSSIRSYYDFPEGSITIRFEANEKEGERSVKKALRYIGAAQSASKREAAGSKE
RESVPSPYVGIINSGNTCYISSVLQMMGYVVSKEDIDMDQHFEICCVNNPLECFFCQLMR
VFNKMKESRSKMEINKISILDLIMLIWRDMPMFSKFMQQDAHEFLLFLLEKIKEGESSYL
IPHITSYFEFEVAREISCSECTEKSTSYESMMMMCTCLKGNIRKSVDMFFSPDEWDCECG
GKKSARRFVTVPPKYLIIQVGRYSYNNCKVEKIKDKIGMKSVKLEGFMRKGDVDKPLLKK
LVDDGYQEEHAERALGIFSNDEDKARSLLENSLTDLRPDMKYRVVGCINHSGDNIKAGHY
TWWVYDDEKCYKIDDTNVLNSNVEVLEDGYIFLFR
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgagactgcctgatctctctagattcagagaaaaatgttgttactgctatagtgatgtg
gaggaggggatatctgtatgtggatgtggactttcattttgcaaagggcacgtggacatc
caccttggaaaggccgagtgtcatgttgtatttgagattaaagaggtcggagatgacctt
ggaattgaaatcaaaaacacaatgctcaagcaggaagagattgaagagctaaggataaga
atggaagcgcttgttaagcccggaaatgaagatgagaggatcatctcaaaggatgaggag
gtgggctgtgcgcatggatgtcctgaaggcccatgctccatagagctgggggatcttgaa
agactaagctgcaagctgtgtgatgttcgagcaaggctatgggcttgcttcagctgtggg
tatgtaggatgtggaagagtgcagtatggagtggaggggaacgggcatgcaagggcgcat
tatgaacagacgcagcacaatgtctttgtcctggttccaagccttctcaaggagagctgc
gaggtgttttgctatctctgtgactcaagcataaggtcttactacgattttcctgaaggt
agcattacgattaggtttgaagcaaacgaaaaggaaggagaaagaagtgtgaagaaagca
ctaaggtacattggagcggcccaatcggctagcaagagggaggcagccggcagcaaggaa
agggagtctgttcctagcccatatgtggggattatcaattctggaaacacctgctatatt
tcgtctgttctccagatgatgggatacgttgtttcgaaggaagatattgacatggaccag
cacttcgagatctgctgtgtgaacaatcctctggaatgttttttctgccagttgatgaga
gtgtttaacaagatgaaggagtccaggagtaagatggagattaataagatatcgatctta
gatctcatcatgcttatatggagagacatgcctatgttttccaagttcatgcagcaggat
gcccacgagttcttattattcttgcttgagaagatcaaggagggggaaagctcttaccta
attccccatataacgtcctattttgagtttgaagttgcaagggagatttcctgctctgag
tgcacggagaagtccaccagctacgaatctatgatgatgatgtgcacatgtctgaagggc
aatataaggaagtctgtggacatgttcttttctccggacgagtgggattgtgaatgtggg
ggaaagaagagcgcgagacgatttgtcactgttccaccgaaatatctgataatccaggtt
gggagatattcctacaataactgcaaggtggagaagattaaagacaagattggaatgaaa
agtgttaagctagaaggttttatgagaaagggcgatgtggataagcccctcttaaaaaaa
ctagtcgacgacgggtatcaagaggagcatgcagaaagggctctaggcatcttttccaac
gacgaagacaaggctcgcagcctcctggagaacagcttgacagaccttagaccagacatg
aagtatagggttgtagggtgtatcaatcattcaggggacaacatcaaagcagggcattac
acatggtgggtatacgacgatgaaaagtgctataagatagatgatacaaatgttcttaac
agcaatgtcgaggtattagaagatggatatatattcttgtttagatga

DBGET integrated database retrieval system