KEGG   Encephalitozoon hellem: EHEL_031290Help
Entry
EHEL_031290       CDS       T02287                                 

Definition
histone deacetylase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ehe  Encephalitozoon hellem
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III:complement(148471..149718)
Genome map
AA seq 415 aa AA seqDB search
MNNKRVVYFYDPEIGTFSYAMGHPMKPLRVKMTHTLLVGYELYKYMDVLRPFQASYENLT
NFHSVDYINFLSSVSSENMEEMIKDLHKFNIRDDCPVFPGLYDYCRLTSGGSIYAAQKIN
SGKYDVAINWAGGLHHAKRSEASGFCYVNDIVLGILELLKYNKRVLYIDIDVHHGDGVEE
AFYTTDRVMTVSFHKYGDYFPGTGMVTDIGLAKGKGYSVNVPLKDGIDDESYFSIFKPVV
SRVIEVYRPDAIVLQSGADSLSGDKLGCFNLSHLGHSRCIKFVQSFNIPLILLGGGGYTI
GNVSKAWAYGTSVVLDVDIPREIPYNEYFDYYAPTYKIDVPTSNMANQNTRESLEDIIAK
VHENLREVSHAPSVQMSAIPPSFISDESDDEEVSKKREREDSDDYKAFSASREEP
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaataacaagagagtagtctatttctatgacccagaaattggaaccttcagttatgca
atggggcatcccatgaagccgctgagggtaaagatgacccatactctcttagttggatat
gagctttacaagtacatggatgtgctcaggccatttcaggcatcatatgagaatctaaca
aacttccactcggtagactatataaactttttgtccagtgtttctagcgagaacatggag
gagatgattaaagatctccacaagttcaacattagagatgattgccctgtgtttccaggg
ctttatgactactgcaggctcaccagtggaggaagcatttatgcggcccaaaagatcaac
tctggaaaatatgatgttgcaattaactgggcaggagggctacaccatgccaaaagaagc
gaagcctctgggttttgctatgtgaacgacatagtcttgggaatccttgagctcctgaag
tacaacaaaagagttctgtacatagatatagacgtccatcacggagacggtgttgaagag
gcattctataccaccgacagagtgatgacggtctccttccataagtatggagattacttt
cctgggacgggaatggtcactgatattggacttgcaaagggaaagggatactcggtcaat
gttccactgaaagacgggattgacgacgagagctatttcagtatattcaagcctgtcgtt
agcagggtcatagaggtgtataggcctgatgcgattgtactacagtcaggagccgattct
ctttcgggagataagctaggatgctttaatttatctcacctaggccattctaggtgcatt
aaatttgtacagagcttcaacattcctcttatccttcttggagggggaggatacaccatc
ggaaacgtttcaaaggcatgggcatatggaacaagcgttgttctggatgttgacattcct
agggagattccttacaatgagtacttcgactattatgcaccaacgtacaaaatagatgtt
cctacatcaaacatggcaaaccaaaacacaagagaaagcttggaagacattatagcaaag
gtgcacgagaatctgagagaagtttcccacgctccatcggtgcaaatgtcagccatacca
ccctcctttatcagtgatgagagcgatgatgaagaagtttcgaagaaaagggaaagagag
gattctgatgattacaaagcattctctgcttcaagggaagagccgtaa

DBGET integrated database retrieval system