KEGG   Encephalitozoon hellem: EHEL_031560Help
Entry
EHEL_031560       CDS       T02287                                 

Definition
hypothetical protein
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
ehe  Encephalitozoon hellem
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ehe00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
III:178172..179281
Genome map
AA seq 369 aa AA seqDB search
MLLLFVYTLFVLFSCCRGSMMDSIQINEVLPRESGIVIEQDGLIMLQNVTKNIKQFLGGE
PVKIARIGTAYSNVVYMFEIDGNRYIYKEFQEFDEQDEMINSIIGGERVIESNSEFRIEK
CLEGRHAIIKRDLKRIASELRKFHDTRIEGVRSYEEMVKIMLVKCIGEMIREDEKEEISL
SCVEENIRKIRSSCEAVLSDSDRIIWILTKVRDKVFGIPRGDFKEVMCHNDLQPGNILVS
ESSVVFIDFEFAAMGSPVIDIANLFCESGYDYSRYMFVDDCFPSTEEQMEFIQEYMGDSR
DCLEIVELVNGAMAYSHFLWYLWAQCNKRCGCSEHFDYVKYGNSRLLELRKRGFVSASEY
EVLRMNERR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgttgctcttatttgtatatactttgtttgtattgttttcatgttgcaggggaagcatg
atggactcaatacagattaatgaagtactaccaagagaatctgggattgtcatagaacag
gatgggctaataatgcttcagaacgttacgaagaacataaagcagttcttagggggagaa
ccggtcaaaattgccaggatcggtacagcatatagtaatgtagtctacatgtttgaaata
gacggaaatagatacatttacaaggagtttcaagagtttgatgagcaagatgagatgata
aacagtattataggaggggagcgtgtaatagaatcaaacagtgagtttaggattgagaag
tgtctagaaggaagacatgcgatcatcaaaagagatctgaagaggattgcatctgaactt
cggaagttccatgatacacgtattgaaggagtacggagctatgaggagatggtaaaaatc
atgctggtaaaatgtataggagagatgattagagaagatgagaaagaagaaataagtctt
tcatgtgtagaggaaaatataagaaagattaggagctcatgtgaagcagtgctttctgat
tccgatcgtattatttggattttgacaaaggtgagagataaggtgtttgggatacccaga
ggggactttaaagaagtaatgtgccacaacgaccttcaaccgggaaatatactagtaagt
gagtccagtgttgttttcatagattttgagtttgctgcaatgggatcgcctgtgatcgac
atagctaatctgttttgcgaatctgggtacgactactcaagatatatgtttgtggatgac
tgcttcccaagcacagaagagcagatggagttcattcaagaatacatgggagactctaga
gactgcctggaaatagtagaacttgtaaatggtgcaatggcatacagtcactttctgtgg
tatctctgggcacagtgtaacaagcgatgcgggtgctcagaacattttgactacgtgaag
tatggaaactcgcgattgctagagctgcgtaagagaggttttgtaagtgcctcagaatat
gaggtgctccgaatgaacgaaagaagatga

DBGET integrated database retrieval system