KEGG   Encephalitozoon hellem: EHEL_050080Help
Entry
EHEL_050080       CDS       T02287                                 

Definition
folic acid synthesis protein
Orthology
K13939  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:4.1.2.25 2.7.6.3 2.5.1.15]
Organism
ehe  Encephalitozoon hellem
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ehe00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V:complement(8515..10674)
Genome map
AA seq 719 aa AA seqDB search
MTPVEQLQLSDLQGFLPVIVSECDHRIEKAVGVTLKMDVKLSDVCARDCVSRTLDLGLCV
RRIREYWEALECAVYVWDFSRRMAEIVDGLGGEGRIEVAVKLPGSSSLSKEVVYKARRDG
GWSELLVVGDICGRVLIGCKDAERCQRQDIRVEVEGMYPKVAPERLPRINTQSLISSIIG
EMERGEYNTMECLASRIVDFVEERYCFVRVCVFLQKMHGALGGLSSGVRIGRATRHALAE
RGHAEAKGGEDLRTAYICVGSNMGDKVGNIHSGLKLLKECGVEIVDTSFLYLSGYQGDGE
VSDREFVNAGVKIRTLHSASSLLRVVKGIEERVGRMKARGTDDRKIDLDIVFYEDLVVDS
RDLVIPHPRLHLREWVLRPLADIDPFFMDPLRKMSVRCLLEGCLRKIDLRASVGLDVERM
PFVGVERVMWLGSKLYRWGSLGSTLVMGILNVTPDSFSDGGCYLSLCDARKRFIEMVEQG
ADIVDIGGVSTRPGAASVDVEEEYSRVIPVLEDVRKIDKDVIISIDTTSARIARECLRRG
ANFMNTTLHADGMAEMYEVVADLSVPIVLMHSRGTPRTMGSLVSSARGQSLLEEVSKETN
DILMEARRSGVYRWNIILDPGIGFAKTPMQSVEVMSGYHRHHPFSSYPCLVGHSRKSFIE
KVGLSVPGDCVHPATLWGTLGGTSMLCRSKTFIVRVHDVPENASIVKLYGLLGSSGLDP
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgacccctgttgagcaacttcagctgtctgatcttcagggctttctccctgtgatagtt
tctgagtgcgaccacaggatagagaaggcggttggagtgacgttgaagatggatgtcaag
ctttctgatgtctgtgcgagggattgcgtgtcgaggacgctggaccttgggttgtgtgtg
agaaggatccgggagtactgggaggccttggagtgtgcggtatatgtgtgggacttttct
cgaaggatggccgagatagttgatgggcttggaggagagggaaggattgaggtagcagtc
aagcttcctggaagtagctctctttcgaaggaggttgtatacaaggcgaggagagacggg
ggatggagtgagctgttggtggtcggggatatctgtggcagggtgcttatagggtgcaag
gatgcggagaggtgccagaggcaggatatcagggtagaggttgaggggatgtatccaaag
gtagctccggagcgccttcctcggatcaacacgcagtctttgatttcctctattatcggg
gagatggagaggggagagtataacaccatggagtgcttggcaagccgaattgttgatttt
gtggaggagagatactgttttgtaagggtctgtgttttccttcagaagatgcatggggct
cttggaggattgagctccggagtgaggatagggagggcgacgcggcatgccttggcggag
agagggcatgcggaggctaaaggaggagaggatctgaggacggcatacatatgtgtagga
tcgaacatgggggacaaggtcggcaacattcactctgggcttaagctgctgaaggagtgt
ggggttgagatagtggacacctcgttcctgtatctttccgggtaccaaggggatggggag
gtttctgatagggagtttgtgaatgcaggggtcaagataaggactctgcactctgcctcc
tcgcttcttcgggtggtgaaggggatagaagagcgtgttgggaggatgaaggcaaggggg
acggatgataggaagattgaccttgacattgtgttttacgaggatcttgttgttgacagc
agggatctagtgataccgcatccccgcctgcacctgcgtgagtgggtgttgaggccactt
gcagacattgatcctttcttcatggatcctcttcggaagatgtctgttaggtgtctgctt
gagggctgtttgaggaagattgacctcagggctagtgttgggctagatgttgaaaggatg
ccctttgtgggtgtggagagggtgatgtggcttggaagcaagctgtacagatgggggtct
ctaggaagtacgctggtgatggggatactgaatgtgacgccggacagtttttctgatggc
gggtgctatcttagtctctgtgatgctcggaagaggtttattgagatggtggaacaaggt
gcggatatagttgacatagggggagtgtccacaaggcccggggccgcctcggtagatgtt
gaggaggaatattccagggtgattcctgtgctagaggatgtaaggaagatagacaaggat
gtcattatatcgattgatacgacgtcggctaggatagcacgtgaatgcctgaggcgggga
gcaaatttcatgaacacgactctgcatgcagatgggatggcggagatgtatgaggttgtt
gcagacctgagtgtaccgattgttcttatgcattcgcgggggactccgaggacgatgggg
tccctggtttcctctgcacgtgggcaaagccttctggaagaagtctcgaaggagaccaac
gatattctgatggaggccagaaggagtggggtctacagatggaacatcattctagatccc
gggatagggtttgcaaagactccgatgcagagtgttgaggtgatgtctgggtaccatagg
catcatccgttttctagctatccttgtcttgtgggacattcgaggaagagctttatcgag
aaggtcgggctatctgtgcctggagattgtgtgcaccccgctaccctgtgggggacgctt
gggggcacttctatgctttgccgtagtaagacctttattgtaagggtccatgatgtgcct
gaaaacgcatcgattgtcaagctttacggtttgctcggtagcagtgggctggatccctag

DBGET integrated database retrieval system