KEGG   Encephalitozoon hellem: EHEL_050120Help
Entry
EHEL_050120       CDS       T02287                                 

Definition
patatin-like phospholipase domain-containing protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
ehe  Encephalitozoon hellem
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ehe00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V:15276..17990
Genome map
AA seq 904 aa AA seqDB search
MFPLGLLIILIIVGGLLAGLKHYGTSKSRAAPFKIKSRAIEKVTFARSLGMTLEDAMKRH
PLFNFYPGQSIKEILDRWDRITYKNGEIIAVAGFVLQGSVEIWYGNQLLCIKERGSLLNG
SMELLGHGAIGTKKARGFVEILLIDPSLVRSNSLYILFSMLRKSCIETACKYFGLEGKLV
EKETMKIRSAEKNHLSLFSTFLCDRFLPSQDDGREILEKSIEARFVGKGMVLKEDEEPMD
YILYVVSGEILVMAGENVFSFGSGSVFGYFSLFFDSYESVKIQAKEDSSTFICNSSTLFK
LGLDEKKFDYSILQDIDESLHVIDESVEWIRLSPGSMIAQKGEASKEIFYIAAGRVKSTS
KEFSSGKAIGGKECIFGENWSESFIATRITDIIQIPSLLVDYFFENDKSFFKKYTKRLFE
NGNKKNGKIVSIIPVGQYKDIDSFSRRLKGAIGASSLLLSRKDVVDILARRSFDTTEELG
FMDYLTKMSKCYEIILIYVENEYSRLLRYLLNFSDVLLTVGTTFTDIPEYNVYCRIEFVK
IYEERRALGEKSMKRRKGIGYGFRRTTDKKEAEGRYDRIHHVLFPSKAVLFCSKDFQRLA
RSLLGKRIGLVLGGGGARGLAHIGVIQALEEEGIPIDCVGGTSMGAFIGALYAKECNNYY
VFKQAKRFSRKMSNIWLLLLDLTYPICSMFSGNAFNRSLHSVFGDGLIQDLWLEYFCITT
NISNYEEEVHRNGMVWRYVRASMGLCGYLPPICDNKRLLVDGGYLNNVPADVMMEMQVKK
IITVDVGTVLENDYFDYGDALSGFTILFNKFFGNKKFVTMEEIQYRLAYISTERKMKELQ
ANDNIVMLRPDLGKYRTMDFKKFDEIVACGYQSTKDAILRWKKEGVFDALFDLKKQAPRR
RYSV
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgtttccactaggtcttttaattatactgattattgtaggtgggcttcttgccgggctc
aagcattatggtacctcaaaatccagggcagcacccttcaagattaagtctagggccatt
gagaaggttacatttgcgaggtctcttgggatgactttagaagacgcaatgaaaaggcat
ccgctattcaatttttacccagggcaatctatcaaggaaatcttggatagatgggataga
ataacatacaaaaatggtgaaataatagcagtcgcaggatttgtgttacagggctccgta
gaaatatggtatggaaatcaacttctttgtataaaggaaagaggatctcttctcaatggg
tccatggagttgctaggacatggtgcaataggaaccaaaaaagcaagaggttttgtcgaa
attcttttgattgatccatctttggtcagaagcaatagcttgtatattttattttccatg
cttagaaaatcatgtatcgaaacggcttgcaagtactttgggctggaaggcaaactagtg
gaaaaggagactatgaagatcagaagtgctgagaagaaccatttaagtctattttcgact
tttttgtgtgataggtttttgccatcccaagatgatggaagagaaatactcgaaaaaagc
attgaggccaggtttgttggcaagggcatggtccttaaagaagacgaagaacctatggac
tatatactgtatgtagtttctggagagattctggtgatggctggggaaaatgtctttagc
tttgggagtgggtctgtatttggatatttttctttattctttgattcctatgagtctgtt
aagatccaggcaaaggaggactcttcaactttcatatgcaactcatcaaccttatttaag
cttggactagacgagaagaagtttgactattcgatactacaggacatcgatgaatcgtta
cacgttatagatgaatcggttgaatggataaggctctctcctggaagcatgattgctcag
aagggagaggcctcgaaagaaatcttttacattgcggctgggagggtaaaatctacatct
aaggaattttcgtctggaaaggctatcggaggaaaagaatgcatttttggagagaactgg
tcggagtcgtttatagcaactcgaataacagacattatacagattccatctcttttggtg
gactatttctttgagaatgacaagagctttttcaaaaagtacaccaaaaggctttttgaa
aatggaaacaaaaagaatggcaaaatagttagtataattccggttggtcaatacaaggac
atagattccttttcgagaaggctgaagggtgcgattggcgcgtcttcgttacttttgagc
cgtaaagatgttgttgacattctagcaaggagatcgtttgataccactgaagagctcgga
tttatggactatcttacaaagatgtctaagtgctacgaaatcattcttatttatgtagaa
aacgaatattcgagattgttaaggtacttgctgaacttttcggatgttctgctgacggtt
ggaacaacttttacggacatcccggaatacaatgtttactgcaggattgagtttgttaaa
atctacgaggagaggagagctctgggcgaaaagagcatgaagaggcgaaaggggattgga
tatggatttaggagaactacagacaagaaggaagcagaagggagatacgacaggatccac
cacgtcttgtttccttcaaaagccgttcttttctgttcaaaagactttcagaggcttgca
aggtcacttctagggaagaggataggacttgttttgggtgggggaggcgctaggggcctt
gcccatataggggtcatccaagcattagaagaggaaggcatacctatagactgtgttgga
ggcaccagcatgggggcctttattggtgcattgtatgcaaaagagtgcaacaactattat
gtgtttaagcaagcaaagagattttctagaaagatgtcaaacatatggcttcttctccta
gacctgacctatcctatttgctctatgttctctgggaatgcatttaataggtcgttgcat
tctgtatttggcgacggattgattcaagatttgtggctggagtatttctgcataaccacc
aacatatccaactatgaagaagaagtgcatagaaatggaatggtctggagatatgtacgt
gccagcatgggactctgtggatacctgcctccgatatgtgacaataagaggttactggtt
gacggtggatacctgaataatgttcctgctgacgtaatgatggagatgcaagttaagaaa
atcattactgtggacgttggaactgtcctggagaatgactattttgattatggtgatgct
ctcagcgggttcactattctgttcaacaagttttttggcaacaagaagtttgtgaccatg
gaagagattcaatacaggctggcctatatttccacagaacggaagatgaaggagcttcag
gcaaatgataatatagtcatgctgaggccagatcttgggaagtataggacaatggatttt
aagaagtttgatgagattgttgcgtgtggctatcagtctacgaaggatgcaattctgagg
tggaagaaagagggagtttttgatgccctctttgacctgaaaaagcaagcaccaagaaga
aggtattctgtgtaa

DBGET integrated database retrieval system