KEGG   Encephalitozoon hellem: EHEL_051360Help
Entry
EHEL_051360       CDS       T02287                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
ehe  Encephalitozoon hellem
Brite
Enzymes [BR:ehe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     EHEL_051360
Peptidases [BR:ehe01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   EHEL_051360
Transcription machinery [BR:ehe03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     EHEL_051360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
V:complement(167958..169190)
Genome map
AA seq 410 aa AA seqDB search
MPFLGHSRVVPTMDLCAHFEALRNVEKIHKMIISKLDYLRKRGVRPRCQECKAAANLRLC
MQCYCFLCDMDEKLHQHSMFLDLFYTSISCILCAKRYLPSTITARAGGTVLVKIPGSLYE
ILPHVPIKGFSNLGNTCYINAVLSIMINSILIRSEFLLDTHKRCSENRCIVCAMRFLIDS
SYRSGCILTHRFIHTFWSLAPHLSGPGQQDAHEFFMCLLQKIHEVYSTNVADDLECKCLS
HRMFFGVFTSKTICKMCNLEREKEELFATISLECLSSIQSSLNTFFEPEDLRCGMACEAC
REKVSCTRRLEVKRCPNILSLHLKRFSYDKASRKVDSYVALSNTLIVGKGVYDILGFVSH
YGSIDHGHYFSHVILGDKWYKIDDEKIDFVPYPELSTDGLYIAYYLKRGK
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgccattcttggggcatagcagagttgtacccacaatggatttgtgtgcccatttcgaa
gcactaagaaacgttgaaaagatacataaaatgattatctcgaagttggactacctcagg
aaaaggggtgtaagacctagatgtcaagaatgtaaggctgcggccaacctgcggctgtgc
atgcagtgctactgcttcctgtgcgacatggacgaaaagctacatcagcatagcatgttt
cttgacctgttctatacctctatatcttgtattttatgtgccaagagatatcttccaagt
actattacagctagagcaggcggtacagttttggtcaaaatcccagggtcgctgtacgag
attcttccacatgtacctatcaaaggattttccaaccttgggaatacatgctacatcaat
gcggtccttagcataatgatcaactcaattctaataagaagcgaattcttgctagatact
cacaaaaggtgcagtgaaaataggtgcatcgtgtgtgccatgaggtttttgatcgattct
tcctatagatccggatgcattcttacacaccgatttatacatacgttctggtcactagca
cctcatctttcagggcctgggcagcaagacgcgcacgaattctttatgtgcctgcttcaa
aagatccatgaagtatatagtacaaatgttgcagatgaccttgaatgcaaatgcttgtca
catcgaatgttcttcggagtatttacctcgaagacaatttgcaagatgtgcaacctcgaa
agagaaaaagaagagttgtttgcaacgatttcgctggagtgcctttcctccattcaatca
tcgctgaataccttttttgagcctgaagacttgaggtgcggaatggcctgtgaagcatgc
agggaaaaagtgtcgtgcaccaggagattggaagtcaaaagatgcccaaatattctatct
ctccatttgaaaagattttcttatgataaggcgtccagaaaagtggactcttatgtagcc
ttatcaaacacgttaatagtaggcaaaggcgtctatgatatcctaggatttgtaagccat
tatggttctattgaccatggacattatttttcgcatgtcatccttggagataagtggtat
aagattgatgacgagaaaatagactttgttccgtatccagaactctctacagatggccta
tatatagcttactatctcaagagaggaaaatag

DBGET integrated database retrieval system