KEGG   Encephalitozoon hellem: EHEL_060290Help
Entry
EHEL_060290       CDS       T02287                                 

Definition
(RefSeq) single-stranded DNA-binding replication protein A medium subunit
  KO
K10739  
replication factor A2
Organism
ehe  Encephalitozoon hellem
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ehe00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    EHEL_060290
   03420 Nucleotide excision repair
    EHEL_060290
   03430 Mismatch repair
    EHEL_060290
   03440 Homologous recombination
    EHEL_060290
DNA replication proteins [BR:ehe03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    EHEL_060290
DNA repair and recombination proteins [BR:ehe03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     EHEL_060290
   MMR (mismatch exicision repair)
     EHEL_060290
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     EHEL_060290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:complement(40657..41337)
Genome map
AA seq 226 aa AA seqDB search
MDRSDGGYIQSSPKREFLGVKTLRALTIKQINNCEFDEPSSTHLVDSAEVTNIQIIGWVV
SSRISATGSMFVLEDGTGSTDCTFWPSNSYEEEQCKVLEERNLLRISGSLRTFNGKRSVS
VSHLSQVEDSNLITYHFLNCIYQHLFYTRQLQREEVRGDGARLDRVQEDILECYRKNQDE
NGLHINVVIKMLSSKYPENEIRENIDLLLRDCHLYSVDGLEYKTTV
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggatagaagcgatggcggatacatccagagttctccaaaaagagagtttctaggagtc
aagacactaagggcactcacaatcaagcagatcaacaactgcgagtttgacgagccgtcc
tcgacgcatcttgtagactctgcagaggttacaaacattcagatcattggctgggttgtt
tcatcaaggatatcggcaacagggtcaatgttcgttttggaggatggaacaggaagcaca
gattgcacattctggccaagcaattcttacgaggaagagcaatgcaaagtccttgaggaa
agaaatcttctcagaatcagtgggtctctcagaacatttaacggcaagagaagcgtgtct
gtatctcatctgtctcaggtagaagactcgaaccttattacctatcattttctgaactgc
atctaccagcatttattctacactagacagcttcaaagagaagaagtaaggggggatggt
gcaagactcgatagagttcaggaggatatattggagtgttacaggaagaaccaggacgaa
aacgggctccacatcaacgtagtcatcaaaatgctttcatctaagtatcctgaaaacgaa
atcagagaaaatatcgatcttctcctgagagactgtcacctgtacagtgtagatgggctg
gaatacaagacaactgtttaa

DBGET integrated database retrieval system