KEGG   Encephalitozoon hellem: EHEL_060860Help
Entry
EHEL_060860       CDS       T02287                                 

Definition
(RefSeq) ubiquitin C-terminal hydrolase
Organism
ehe  Encephalitozoon hellem
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
VI:112818..114974
Genome map
AA seq 718 aa AA seqDB search
MADGHKGQSSSSDPRQQEYAISSIFAKAQKKFGRALIGGKVSGARIYFVPEDTWKTMKES
SVTEYREGDGPETRGDGRAVFVVFMIDELVPNTVTPEAGKSVIVRVGWIYSILKSLANIS
DFSPSEQPSYGNGMKRSRKIVNVLADPSDKLFDIVLHLMDFRLDLEGFMRNYRVLASNGR
VIHPLAVLGELSDGDVLRISKIIRMGDGRALSVDEHMRNAIRGLKNQGNTCFMNSGLQCL
MNCWKLTEYFISREYESHLEKHKPDHVSLANAYYDLVAQVHDGGTHPITPAGIKRSLGSI
YEEYKGSDEQDTVEFITKMLDTLHEGLSTKIECQKKKEGRGWWDYSKSIVTDLFFFCLRS
TLSCRACGRSKASVEPAMCLSLPVPHPMEHKNDIVLFYESSRKQPIKIYTDSSICIKELK
KLLGTKYGVLGRIACIWYDGSRNMVEAPNDAILRNIPQALFCYEYFEGIEYCWIHLKIKK
LFIDRSLQFNILIKAFAYSEPLMLLEVRRALIYLVQKESQDLLEDEDISPYVKLELPGRA
SKEAARDFPVVIGVSRAHGGRKLLNPLCDPLDMIQAIRPPMPTLNYCIDKFLEKEDLHPS
ELLYCEGCGEKKMFSKKIDLESLPTYLIIQLKRFQYVNSFPMKISTLVEYPLDEFRIGDA
EYRVIGVCNHDSETVTSSGHYVSYLWKDGWYLCNDQKIERVDKIKKEHTYVLFLERCG
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgggcacaagggccaaagctccagctcagatccaaggcagcaggaatacgcc
atctcttctatttttgctaaagcccaaaagaaattcggcagggcacttataggtggcaag
gtatctggggccagaatctattttgttccagaggacacctggaagacgatgaaggagagt
tcagtcacggaatacagagagggcgacgggccagaaacaaggggcgatggaagggcggtc
ttcgttgtctttatgattgatgagcttgttccaaacacagtcacccccgaggcaggcaag
agtgtgattgtcagggtcggatggatctactcgatactcaagtctcttgccaacatcagt
gactttagtcccagcgaacaacctagctatggcaacgggatgaagagatcaaggaagatt
gtaaatgtccttgccgatccttcggacaagctgtttgatatagtactgcacctcatggac
ttccggcttgatctggaagggttcatgagaaactacagggtcctagcatccaacggcagg
gtgattcacccccttgcggttctgggcgagctttctgatggggacgtgctaaggatctca
aaaatcataagaatgggggacggaagagctctatctgttgacgagcacatgaggaatgct
atccgagggctcaagaaccaaggaaacacgtgctttatgaacagtgggcttcaatgcctg
atgaactgttggaagcttaccgagtacttcatcagtagagaatatgaaagccacttggaa
aagcacaagcctgaccatgtgtccttggctaatgcatattatgatcttgttgcacaagta
catgacggagggacacaccccatcacgccagcaggaatcaaaagaagcttgggatcgata
tacgaggaatacaagggaagtgatgagcaggacacagtggagtttatcacgaagatgctg
gacacactgcacgagggcctctcaaccaaaatagaatgccaaaagaaaaaggaaggaagg
ggatggtgggactacagcaagtcgattgtcactgatctgtttttcttctgtctgagatct
acgctgtcatgcagggcttgcggaaggagcaaagcctctgtggagcctgcgatgtgcctt
tctctgcctgtcccgcatcccatggagcacaagaacgacattgtgctgttctacgagtcg
agcagaaagcagcccataaaaatatacacggacagctccatctgtatcaaggaactcaag
aagttactagggaccaagtatggagttttgggaaggattgcatgtatatggtatgatggc
agcagaaatatggttgaggcaccaaacgatgccattctaagaaatatcccgcaggcccta
ttctgctacgagtattttgagggcatagagtactgttggattcatctgaagattaagaag
ctatttatagataggtcgcttcagttcaatatactgatcaaagcgtttgcctatagcgag
ccactaatgcttttagaagttcggagggcactcatttaccttgtccagaaagagtcacaa
gatctcctggaagatgaagatatatctccctatgttaagctggagttgcctggtcgggca
tctaaggaggctgcaagagactttcctgttgtgataggagtaagcagggcacatggggga
aggaagctcctcaaccccctgtgcgatcccttagatatgatacaggccataaggccgccg
atgcctacacttaattactgcatagacaagtttctggagaaggaagacctccatccatcc
gagcttctgtactgtgaaggatgtggtgaaaagaaaatgtttagcaagaagattgatcta
gagagcctcccaacatacctcataatccagctgaaaagattccagtatgtcaattctttt
cccatgaagatctcgaccctagttgagtatcctcttgatgagtttcgcattggggatgca
gaatacagagtcataggagtatgtaaccatgactctgagacggttacatcgagcgggcat
tatgtaagctacctgtggaaggacgggtggtatctctgcaatgaccagaagattgagagg
gttgacaagattaagaaggagcacacatatgttctcttccttgagagatgtggctag

DBGET integrated database retrieval system