KEGG   Encephalitozoon hellem: EHEL_060860Help
Entry
EHEL_060860       CDS       T02287                                 

Definition
ubiquitin C-terminal hydrolase
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
ehe  Encephalitozoon hellem
Brite
Enzymes [BR:ehe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     EHEL_060860
Peptidases [BR:ehe01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   EHEL_060860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:112818..114974
Genome map
AA seq 718 aa AA seqDB search
MADGHKGQSSSSDPRQQEYAISSIFAKAQKKFGRALIGGKVSGARIYFVPEDTWKTMKES
SVTEYREGDGPETRGDGRAVFVVFMIDELVPNTVTPEAGKSVIVRVGWIYSILKSLANIS
DFSPSEQPSYGNGMKRSRKIVNVLADPSDKLFDIVLHLMDFRLDLEGFMRNYRVLASNGR
VIHPLAVLGELSDGDVLRISKIIRMGDGRALSVDEHMRNAIRGLKNQGNTCFMNSGLQCL
MNCWKLTEYFISREYESHLEKHKPDHVSLANAYYDLVAQVHDGGTHPITPAGIKRSLGSI
YEEYKGSDEQDTVEFITKMLDTLHEGLSTKIECQKKKEGRGWWDYSKSIVTDLFFFCLRS
TLSCRACGRSKASVEPAMCLSLPVPHPMEHKNDIVLFYESSRKQPIKIYTDSSICIKELK
KLLGTKYGVLGRIACIWYDGSRNMVEAPNDAILRNIPQALFCYEYFEGIEYCWIHLKIKK
LFIDRSLQFNILIKAFAYSEPLMLLEVRRALIYLVQKESQDLLEDEDISPYVKLELPGRA
SKEAARDFPVVIGVSRAHGGRKLLNPLCDPLDMIQAIRPPMPTLNYCIDKFLEKEDLHPS
ELLYCEGCGEKKMFSKKIDLESLPTYLIIQLKRFQYVNSFPMKISTLVEYPLDEFRIGDA
EYRVIGVCNHDSETVTSSGHYVSYLWKDGWYLCNDQKIERVDKIKKEHTYVLFLERCG
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgggcacaagggccaaagctccagctcagatccaaggcagcaggaatacgcc
atctcttctatttttgctaaagcccaaaagaaattcggcagggcacttataggtggcaag
gtatctggggccagaatctattttgttccagaggacacctggaagacgatgaaggagagt
tcagtcacggaatacagagagggcgacgggccagaaacaaggggcgatggaagggcggtc
ttcgttgtctttatgattgatgagcttgttccaaacacagtcacccccgaggcaggcaag
agtgtgattgtcagggtcggatggatctactcgatactcaagtctcttgccaacatcagt
gactttagtcccagcgaacaacctagctatggcaacgggatgaagagatcaaggaagatt
gtaaatgtccttgccgatccttcggacaagctgtttgatatagtactgcacctcatggac
ttccggcttgatctggaagggttcatgagaaactacagggtcctagcatccaacggcagg
gtgattcacccccttgcggttctgggcgagctttctgatggggacgtgctaaggatctca
aaaatcataagaatgggggacggaagagctctatctgttgacgagcacatgaggaatgct
atccgagggctcaagaaccaaggaaacacgtgctttatgaacagtgggcttcaatgcctg
atgaactgttggaagcttaccgagtacttcatcagtagagaatatgaaagccacttggaa
aagcacaagcctgaccatgtgtccttggctaatgcatattatgatcttgttgcacaagta
catgacggagggacacaccccatcacgccagcaggaatcaaaagaagcttgggatcgata
tacgaggaatacaagggaagtgatgagcaggacacagtggagtttatcacgaagatgctg
gacacactgcacgagggcctctcaaccaaaatagaatgccaaaagaaaaaggaaggaagg
ggatggtgggactacagcaagtcgattgtcactgatctgtttttcttctgtctgagatct
acgctgtcatgcagggcttgcggaaggagcaaagcctctgtggagcctgcgatgtgcctt
tctctgcctgtcccgcatcccatggagcacaagaacgacattgtgctgttctacgagtcg
agcagaaagcagcccataaaaatatacacggacagctccatctgtatcaaggaactcaag
aagttactagggaccaagtatggagttttgggaaggattgcatgtatatggtatgatggc
agcagaaatatggttgaggcaccaaacgatgccattctaagaaatatcccgcaggcccta
ttctgctacgagtattttgagggcatagagtactgttggattcatctgaagattaagaag
ctatttatagataggtcgcttcagttcaatatactgatcaaagcgtttgcctatagcgag
ccactaatgcttttagaagttcggagggcactcatttaccttgtccagaaagagtcacaa
gatctcctggaagatgaagatatatctccctatgttaagctggagttgcctggtcgggca
tctaaggaggctgcaagagactttcctgttgtgataggagtaagcagggcacatggggga
aggaagctcctcaaccccctgtgcgatcccttagatatgatacaggccataaggccgccg
atgcctacacttaattactgcatagacaagtttctggagaaggaagacctccatccatcc
gagcttctgtactgtgaaggatgtggtgaaaagaaaatgtttagcaagaagattgatcta
gagagcctcccaacatacctcataatccagctgaaaagattccagtatgtcaattctttt
cccatgaagatctcgaccctagttgagtatcctcttgatgagtttcgcattggggatgca
gaatacagagtcataggagtatgtaaccatgactctgagacggttacatcgagcgggcat
tatgtaagctacctgtggaaggacgggtggtatctctgcaatgaccagaagattgagagg
gttgacaagattaagaaggagcacacatatgttctcttccttgagagatgtggctag

DBGET integrated database retrieval system