KEGG   Encephalitozoon hellem: EHEL_061540Help
Entry
EHEL_061540       CDS       T02287                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
ehe  Encephalitozoon hellem
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ehe00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    EHEL_061540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VI:complement(188684..189640)
Genome map
AA seq 318 aa AA seqDB search
MAQYSAKISDIPNPPSDTVSEIAFSQMHSLMAVSSWDGTIRTYDLENPYSSNTSVVNLNK
PLLTCCFSKETPSLTFAGAADGSLQMVDLQTSRVSSFQAHNAGVKSVRCFSNMLATGSWD
KTVKFWDIRSSKLVFSLDLPGKVYAMDLEKELLAISLSGNEVVTYNLNDINQKKTHASKL
NWMIRSIACAQDNETFALGGIEGKAEIFNINSPVKKMIFRCHRVDNKVYAVNSVSFLPTN
HNILVTAGGDGTIVFFDAQARMKIFTQTESQPITCGRFNTNGSYYVYATGNDWSTGYVTT
YRPTQLKAIQVSTTGVKI
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggctcagtatagtgctaagatttctgatatcccaaatcctccatcagatacggtttct
gagatagcatttagccagatgcatagcctgatggcagtatcgagctgggatggcactatc
cgaacatacgatttggaaaacccatacagctcaaataccagtgtggtgaatctaaacaag
cctcttcttacgtgctgcttcagcaaagagacaccctcattaacttttgcaggcgcagca
gatggaagcctccaaatggtagatctacagaccagtcgggtatcatctttccaagcacac
aatgcaggagtaaaatctgtaagatgcttttcaaacatgctggcaactgggtcatgggat
aaaactgttaagttttgggatatccggtcctcaaagcttgtattctctttagaccttcct
ggaaaagtttatgccatggaccttgagaaagaactacttgcaatatctctttctggaaat
gaggtggtaacatacaatctcaacgacataaaccagaagaaaacgcatgcttcaaagctg
aactggatgattagatcaatagcctgtgctcaagacaacgagacttttgcccttggggga
atagaaggaaaggcagagatatttaacatcaactctccagtaaagaaaatgatatttaga
tgccacagagttgataacaaggtttatgctgtcaattctgtatctttccttccaaccaat
cacaatatattggttactgcgggcggagacggaaccatagtgtttttcgatgcacaagca
agaatgaaaatatttacccagacagaaagtcagcctataacatgtggtagattcaacact
aatggaagttactatgtctatgcaaccgggaatgactggtccacgggatatgtgacaact
tacaggcccacacagcttaaagccatccaggtcagcactacaggtgtaaaaatatga

DBGET integrated database retrieval system