KEGG   Encephalitozoon hellem: EHEL_061540Help
Entry
EHEL_061540       CDS       T02287                                 

Definition
(RefSeq) hypothetical protein
  KO
K14298  mRNA export factor
Organism
ehe  Encephalitozoon hellem
Pathway
ehe03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ehe00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    EHEL_061540
Messenger RNA biogenesis [BR:ehe03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     EHEL_061540
Chromosome and associated proteins [BR:ehe03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    EHEL_061540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Nup160 Utp8
Motif
Other DBs
NCBI-GeneID: 13467508
NCBI-ProteinID: XP_003887504
UniProt: F8V7C7
Position
VI:complement(188684..189640)
Genome map
AA seq 318 aa AA seqDB search
MAQYSAKISDIPNPPSDTVSEIAFSQMHSLMAVSSWDGTIRTYDLENPYSSNTSVVNLNK
PLLTCCFSKETPSLTFAGAADGSLQMVDLQTSRVSSFQAHNAGVKSVRCFSNMLATGSWD
KTVKFWDIRSSKLVFSLDLPGKVYAMDLEKELLAISLSGNEVVTYNLNDINQKKTHASKL
NWMIRSIACAQDNETFALGGIEGKAEIFNINSPVKKMIFRCHRVDNKVYAVNSVSFLPTN
HNILVTAGGDGTIVFFDAQARMKIFTQTESQPITCGRFNTNGSYYVYATGNDWSTGYVTT
YRPTQLKAIQVSTTGVKI
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggctcagtatagtgctaagatttctgatatcccaaatcctccatcagatacggtttct
gagatagcatttagccagatgcatagcctgatggcagtatcgagctgggatggcactatc
cgaacatacgatttggaaaacccatacagctcaaataccagtgtggtgaatctaaacaag
cctcttcttacgtgctgcttcagcaaagagacaccctcattaacttttgcaggcgcagca
gatggaagcctccaaatggtagatctacagaccagtcgggtatcatctttccaagcacac
aatgcaggagtaaaatctgtaagatgcttttcaaacatgctggcaactgggtcatgggat
aaaactgttaagttttgggatatccggtcctcaaagcttgtattctctttagaccttcct
ggaaaagtttatgccatggaccttgagaaagaactacttgcaatatctctttctggaaat
gaggtggtaacatacaatctcaacgacataaaccagaagaaaacgcatgcttcaaagctg
aactggatgattagatcaatagcctgtgctcaagacaacgagacttttgcccttggggga
atagaaggaaaggcagagatatttaacatcaactctccagtaaagaaaatgatatttaga
tgccacagagttgataacaaggtttatgctgtcaattctgtatctttccttccaaccaat
cacaatatattggttactgcgggcggagacggaaccatagtgtttttcgatgcacaagca
agaatgaaaatatttacccagacagaaagtcagcctataacatgtggtagattcaacact
aatggaagttactatgtctatgcaaccgggaatgactggtccacgggatatgtgacaact
tacaggcccacacagcttaaagccatccaggtcagcactacaggtgtaaaaatatga

DBGET integrated database retrieval system