KEGG   Encephalitozoon hellem: EHEL_070380Help
Entry
EHEL_070380       CDS       T02287                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase
Organism
ehe  Encephalitozoon hellem
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
VII:50458..51351
Genome map
AA seq 297 aa AA seqDB search
MVVQEKKSNLPPKGLKNKGNTCFFNSAMQCILSISELNAFYRDTLFPREKKISNAFKQFI
LEYEDSAQSCDPRNLISVFNTKMKLFNGMQQDSHEFLIQFIDLLYTEFDWNKDVFTTIDE
FEEARKQNLIAKTLLSMDRQILICEMCKYSSTTIVTNSTILIEPYASVQEGIDRYYEEVM
LEGEDSWKCDKCGKKKGTIKRMENLIHPEVLIVHISRFHPRGSKDTASVDISATLSFNNR
KYSLFGVVCHTGTLSGGHYFAEAKRSGTWRIYNDEQVTKGFKGYNGSHPYMAFYTLW
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggtagtacaggagaaaaaatccaatctccctccaaaaggattaaagaataagggaaat
acttgtttcttcaattctgcaatgcagtgtattttgtccattagcgagcttaacgccttt
tatcgggacaccctttttccaagggagaagaagatatctaatgcattcaaacaatttata
cttgagtatgaagattcggcacagtcctgtgacccaagaaacctcatcagcgtatttaac
acaaagatgaagctgttcaatgggatgcagcaggactctcacgagtttcttattcagttt
atcgatttgctgtatacagagtttgattggaataaagatgtgtttacaacaatagatgaa
tttgaggaagcccggaagcagaatctgattgcaaaaacattactttcaatggatagacag
atactaatatgcgagatgtgtaaatactcttctacaacaattgtcacgaatagtaccatt
cttattgaaccctatgcatcagttcaggaaggaatagatcggtattacgaagaggtgatg
cttgagggagaagatagctggaaatgcgataaatgtggaaagaagaagggcactataaag
aggatggaaaaccttatacatccagaagtcctgatagtgcatatatcaagattccatcca
cgaggatcaaaagacacggcaagtgtcgacattagcgccactttgtcttttaacaataga
aagtacagcctcttcggggttgtgtgccacaccggaactctgagtgggggacactacttt
gcagaggccaaaaggtcaggtacatggaggatctacaacgatgaacaagtgacaaaaggc
ttcaagggctacaatggatcacatccctacatggctttctacactctttggtag

DBGET integrated database retrieval system