KEGG   Encephalitozoon hellem: EHEL_070490Help
Entry
EHEL_070490       CDS       T02287                                 

Definition
(RefSeq) serine/threonine kinase
Organism
ehe  Encephalitozoon hellem
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII:64395..65369
Genome map
AA seq 324 aa AA seqDB search
MLKIRDFEFAKVVGEGAFGKVYLVKLKSNPSTVFAIKMLEFDEILKQRLADQLENEISIL
KRLYGCPFVAKLYSTDFYCGKVGLILEYVGGGELFYWLKKCGRFDENMTRFYAAEIISAL
RFIHGKGILYRDLKPENILITSSGHIKLIDFGFAVYENESIYMISGTPEYMSPEKLRSED
DGRASDYWGLGIIIYEMLCGDPPFYDASADTIYHKILESQITFPSYVSPVARSLISGLLD
KSRATRLGAKGIYEIMGHPFFKEIDWSKIESKRISPPFVPSPNIVMSFLDGSTKAKDISK
IETVVMKPYKHIKHFQRDQTSKRL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagatccgagactttgagtttgcgaaagtcgtgggggagggcgcctttgggaaa
gtgtatctggtgaagcttaagagcaatccgtccactgtgtttgcaataaagatgcttgag
tttgacgagatcctcaagcaaaggctggcagatcaacttgaaaacgagatctccatcctg
aagaggctttacgggtgtccatttgttgcgaagctatactcgactgacttctattgcggg
aaggtgggacttatcttggagtatgttggaggaggagagctgttttactggctcaagaag
tgtgggaggtttgacgagaacatgacacggttttatgcggcagagattatttccgcccta
agatttatacacggaaaaggcatactttatagggacttgaagcctgagaatatattgatt
acgtcttctgggcatataaagttgattgattttggatttgctgtttatgaaaatgagagt
atatacatgatttcaggaacaccagaatacatgtctccggaaaagctgaggagtgaggat
gacgggcgtgcaagtgactactgggggcttggaatcataatttatgagatgctgtgtggg
gacccgccgttttacgatgcaagcgccgacactatctaccataagatacttgagtcccag
atcacctttccttcctatgtgagtcctgtggcaaggagcttgatatcaggactgctggac
aagagtagggcaactaggctgggagccaagggaatatacgagataatggggcatcctttt
ttcaaagaaatagattggagtaagattgagagcaagaggatatcgcctccatttgttcca
agtccaaacatcgttatgagcttcttggacggcagtaccaaggctaaagatataagcaaa
attgaaacagttgttatgaagccatacaagcacattaagcactttcagagagatcaaact
tcaaaaagattgtaa

DBGET integrated database retrieval system