KEGG   Encephalitozoon hellem: EHEL_070490Help
Entry
EHEL_070490       CDS       T02287                                 

Definition
serine/threonine kinase
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ehe  Encephalitozoon hellem
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:ehe00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    EHEL_070490
Enzymes [BR:ehe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     EHEL_070490
Protein kinases [BR:ehe01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   EHEL_070490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VII:64395..65369
Genome map
AA seq 324 aa AA seqDB search
MLKIRDFEFAKVVGEGAFGKVYLVKLKSNPSTVFAIKMLEFDEILKQRLADQLENEISIL
KRLYGCPFVAKLYSTDFYCGKVGLILEYVGGGELFYWLKKCGRFDENMTRFYAAEIISAL
RFIHGKGILYRDLKPENILITSSGHIKLIDFGFAVYENESIYMISGTPEYMSPEKLRSED
DGRASDYWGLGIIIYEMLCGDPPFYDASADTIYHKILESQITFPSYVSPVARSLISGLLD
KSRATRLGAKGIYEIMGHPFFKEIDWSKIESKRISPPFVPSPNIVMSFLDGSTKAKDISK
IETVVMKPYKHIKHFQRDQTSKRL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagatccgagactttgagtttgcgaaagtcgtgggggagggcgcctttgggaaa
gtgtatctggtgaagcttaagagcaatccgtccactgtgtttgcaataaagatgcttgag
tttgacgagatcctcaagcaaaggctggcagatcaacttgaaaacgagatctccatcctg
aagaggctttacgggtgtccatttgttgcgaagctatactcgactgacttctattgcggg
aaggtgggacttatcttggagtatgttggaggaggagagctgttttactggctcaagaag
tgtgggaggtttgacgagaacatgacacggttttatgcggcagagattatttccgcccta
agatttatacacggaaaaggcatactttatagggacttgaagcctgagaatatattgatt
acgtcttctgggcatataaagttgattgattttggatttgctgtttatgaaaatgagagt
atatacatgatttcaggaacaccagaatacatgtctccggaaaagctgaggagtgaggat
gacgggcgtgcaagtgactactgggggcttggaatcataatttatgagatgctgtgtggg
gacccgccgttttacgatgcaagcgccgacactatctaccataagatacttgagtcccag
atcacctttccttcctatgtgagtcctgtggcaaggagcttgatatcaggactgctggac
aagagtagggcaactaggctgggagccaagggaatatacgagataatggggcatcctttt
ttcaaagaaatagattggagtaagattgagagcaagaggatatcgcctccatttgttcca
agtccaaacatcgttatgagcttcttggacggcagtaccaaggctaaagatataagcaaa
attgaaacagttgttatgaagccatacaagcacattaagcactttcagagagatcaaact
tcaaaaagattgtaa

DBGET integrated database retrieval system