KEGG   Encephalitozoon hellem: EHEL_080080Help
Entry
EHEL_080080       CDS       T02287                                 

Definition
EF-Hand Ca2+-binding protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ehe  Encephalitozoon hellem
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VIII:6971..7573
Genome map
AA seq 200 aa AA seqDB search
MGLLSSTMLCEEEIEELKNTTFFDEREIEHLYERFQFLDKESRGYLTYNELNNIPEFQSN
PFSHLIMKSIEKMTDYEKMTFPHFLEFLGIFSEKASKKSRIRYLFDIFDLNGDGRLCRNV
LIRVNKMMGQDGKTEEIENLLNIYDEGGKGYLDISDFSKFYESDPLIDKNMIIDFSKNLK
RRKQVGFMQVLWPSTYKDGE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggggcttctaagtagcacaatgctttgtgaagaggaaatagaggagctaaaaaacacc
acctttttcgacgaaagagagatagagcacttgtacgagagattccagtttctagataaa
gagtctcgtggatacctcacatataacgagctgaacaatatccctgagttccaatcaaat
cctttcagtcatctaataatgaagagtattgagaagatgacagattacgaaaaaatgaca
tttccccattttctcgagttcctggggattttttccgagaaggccagcaagaaaagcagg
ataagatacctatttgatatcttcgacttgaacggagatggtaggctttgtagaaatgtc
cttatcagagttaacaagatgatgggtcaggatggaaaaacagaagaaatcgaaaatctc
ttaaacatttatgacgaaggaggaaaaggatacttggacatatctgattttagcaaattt
tatgaaagtgacccgcttatcgataagaacatgatcattgacttctcgaagaatctaaag
cggcgtaagcaggtgggattcatgcaggtattatggccatcgacctacaaagacggagaa
tga

DBGET integrated database retrieval system