KEGG   Encephalitozoon hellem: EHEL_080080Help
Entry
EHEL_080080       CDS       T02287                                 

Definition
(RefSeq) EF-Hand Ca2+-binding protein
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ehe  Encephalitozoon hellem
Brite
Protein phosphatases and associated proteins [BR:ehe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     EHEL_080080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5
Motif
Other DBs
NCBI-GeneID: 13467956
NCBI-ProteinID: XP_003887695
UniProt: I6UDQ8
Position
VIII:6971..7573
Genome map
AA seq 200 aa AA seqDB search
MGLLSSTMLCEEEIEELKNTTFFDEREIEHLYERFQFLDKESRGYLTYNELNNIPEFQSN
PFSHLIMKSIEKMTDYEKMTFPHFLEFLGIFSEKASKKSRIRYLFDIFDLNGDGRLCRNV
LIRVNKMMGQDGKTEEIENLLNIYDEGGKGYLDISDFSKFYESDPLIDKNMIIDFSKNLK
RRKQVGFMQVLWPSTYKDGE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggggcttctaagtagcacaatgctttgtgaagaggaaatagaggagctaaaaaacacc
acctttttcgacgaaagagagatagagcacttgtacgagagattccagtttctagataaa
gagtctcgtggatacctcacatataacgagctgaacaatatccctgagttccaatcaaat
cctttcagtcatctaataatgaagagtattgagaagatgacagattacgaaaaaatgaca
tttccccattttctcgagttcctggggattttttccgagaaggccagcaagaaaagcagg
ataagatacctatttgatatcttcgacttgaacggagatggtaggctttgtagaaatgtc
cttatcagagttaacaagatgatgggtcaggatggaaaaacagaagaaatcgaaaatctc
ttaaacatttatgacgaaggaggaaaaggatacttggacatatctgattttagcaaattt
tatgaaagtgacccgcttatcgataagaacatgatcattgacttctcgaagaatctaaag
cggcgtaagcaggtgggattcatgcaggtattatggccatcgacctacaaagacggagaa
tga

DBGET integrated database retrieval system