KEGG   Encephalitozoon hellem: EHEL_080330Help
Entry
EHEL_080330       CDS       T02287                                 

Definition
histone H2B-like protein
Orthology
K11252  
histone H2B
Organism
ehe  Encephalitozoon hellem
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VIII:complement(34364..34759)
Genome map
AA seq 131 aa AA seqDB search
MEKLSKHGAGKAPAVALDSADKKKAKKKSSSMCVGGMFKSAVKRISREVSPDNNIMLTSN
SIQVLCGISFDFVDSVAELAGELARKVGKQTVGSDDIISAFEILLKGELRKLAIREVHNA
LSKSQAKSRGK
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaactctcaaaacatggtgcaggcaaagctccagctgttgcactggatagcgcc
gataagaagaaggccaaaaaaaagtcatcgtccatgtgtgttggtggtatgttcaagtct
gcagtcaagcgcatttcccgtgaggtcagcccggacaacaatatcatgctgacaagcaat
tcaatccaggttctttgcggaatctcattcgattttgttgattctgttgctgaacttgca
ggtgagttggcaaggaaggttgggaagcaaacagtggggtccgacgacatcataagtgct
ttcgagatcttgctcaagggcgagctgaggaagttggccatcagagaggtccacaatgct
ctgtctaagagtcaagccaagtcccgtggaaaataa

DBGET integrated database retrieval system