KEGG   Encephalitozoon hellem: EHEL_080860Help
Entry
EHEL_080860       CDS       T02287                                 

Definition
translation initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
ehe  Encephalitozoon hellem
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ehe00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    EHEL_080860
Messenger RNA biogenesis [BR:ehe03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     EHEL_080860
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     EHEL_080860
Translation factors [BR:ehe03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    EHEL_080860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VIII:86581..87102
Genome map
AA seq 173 aa AA seqDB search
MNLASQWVLWQNNNDESNAKSWGDDLVAVGEVSTVPEFLYLCDEISNVGIGKLCTMNLFR
KGVKPMWEDEANIDGGRIIMDVPVVGRDNVGDLWKKTMAFCVSNSVDNVCGCVLSEKQSF
YKLAIWFGKDYNQDTIKEMWQEALGGGNLSVYSFLHKKSLDSNKGKKKWGGRR
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaacttggcgtcgcaatgggttctctggcaaaataacaatgatgagtccaatgccaag
agctggggggacgatctcgtggctgttggggaggtgtcgacggttcctgagtttctgtat
ctttgcgacgagatatcgaatgtcgggattgggaagctgtgcacaatgaatctgtttagg
aagggagtgaagcccatgtgggaggacgaggcgaacatagatggaggaaggatcataatg
gatgttcctgttgttggcagggacaatgtcggggatctgtggaaaaaaacaatggcgttt
tgtgtatcgaacagcgttgacaacgtgtgcggatgtgttcttagcgagaagcagtcattc
tacaagctggccatctggtttgggaaggattataaccaggacaccattaaggagatgtgg
caggaagctctaggaggcgggaatctatctgtctactccttcttacataagaaatcgctg
gacagcaacaaaggaaagaaaaaatggggaggaaggaggtag

DBGET integrated database retrieval system