KEGG   Encephalitozoon hellem: EHEL_081080Help
Entry
EHEL_081080       CDS       T02287                                 

Definition
histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ehe  Encephalitozoon hellem
Brite
Enzymes [BR:ehe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     EHEL_081080
Transfer RNA biogenesis [BR:ehe03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    EHEL_081080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
VIII:complement(105047..106729)
Genome map
AA seq 560 aa AA seqDB search
MSDFLKACNEISNEIIKLYKQEKKIDVNGIKSRVCKKYRLVSTPRVVDIISFIPPEYGHL
IEQLRVKPVRTASGVAVVAVMCKPHRCPHIALTGNICVYCPGGPDSEFEYSTQSYTGYEP
TSMRAIRSRYDPFDQARERLKQLKGLGHSVDKVEYIIMGGTFMSLPESYRDNFILKLHDA
LSGHTSSSVEEAIRVGAEGRLKCVGITIETRPDFCVRPHLSKMLGYGCTRIEIGVQSVYE
DVAMDTNRGHTVSSVCESFGLSKDAGFKIVAHMMPNLPNVPMKRDIAQFREYFDNPAFRS
DGLKIYPTLVIKGTGLFELWKNNKYKNYSPDELIDILARILSFVPPWMRVYRVQRDIPMT
LVSSGVEHGNIRELALARMKDYKTRCRDVRTREVGIKNIHESILPEEVELVRRDYVANKG
WETFLSYEDVKQDILIGLLRLRKCSVDTFRRELKDVGCVPEGDGAKLQEGVYHPAVVNGN
ASIIRELHVYGSAVAISKSDGKKYQHQGYGTLLIAEAERIARDEHKSKKIAIISGVGTRN
YYARFGYVLEGPYMVKDLAS
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacttcctcaaggcatgcaacgagatctcaaacgagataatcaagctctacaag
caggagaagaagatagacgtgaatggaatcaagtccagagtgtgcaagaaatacaggctt
gtgagcacgccgcgtgtggttgacataatctcgttcattcctcccgagtacggccatctc
atcgagcagctccgagtgaagcctgtcagaactgcatcgggagttgctgttgttgcagta
atgtgcaagccccatagatgcccacacatagcattgactggaaacatatgtgtatactgt
cctggtggtcctgactctgagtttgagtattccacccagtcgtatacggggtatgagccg
acaagcatgagggccataagaagtaggtacgatccatttgaccaggcaagggagaggctg
aagcagctcaaagggcttgggcacagtgtagacaaggttgagtacataataatgggagga
acgtttatgtctttgcccgagtcgtacagagacaactttattctgaagctacacgatgct
cttagtgggcacacttcctcgagtgtcgaggaggcaataagggttggagcagaaggacgg
ctgaagtgtgttggaataacaatagagacaagaccagacttctgcgtccgcccgcaccta
agtaagatgctaggatacggatgcacaagaattgagataggagttcagagtgtgtatgaa
gacgttgccatggacaccaacagaggacacaccgtaagcagtgtgtgcgagtcttttggg
ctgtccaaagatgctggattcaagatagttgcacacatgatgcccaacctcccgaatgtc
cccatgaagagggatattgcacagttccgggaatacttcgacaaccctgcatttagaagc
gatgggttgaagatatatcctactctcgtgatcaagggaacgggcctatttgagctgtgg
aagaacaacaaatacaagaactactctcccgacgagcttattgacatacttgcaaggatc
ctttcgtttgtgccgccatggatgagggtgtacagggtgcagagagacattccaatgacg
cttgtgagctctggagtggagcatggcaatataagggagcttgcattggccaggatgaaa
gactataagacaaggtgtagggatgtaaggaccagagaggttgggatcaagaacatccac
gagagtattttgcctgaggaggttgagcttgtgaggagagattacgtggcaaacaagggc
tgggagacgtttcttagctatgaggatgtgaagcaggatatcttgatagggcttctgagg
ctacgcaagtgtagtgtggatacatttcgaagggagctgaaggacgtgggctgtgtaccg
gaaggagatggagccaagcttcaggagggtgtgtatcatcctgcagtggtgaatggaaat
gcatcgataataagagagctccatgtgtatgggagtgctgttgccataagtaagagcgat
gggaaaaagtaccagcatcaaggatatggaacacttctcatagccgaggccgagaggatt
gcaagggacgagcacaaatcaaaaaagatagccatcatttctggcgttggaaccagaaac
tactatgccaggtttggatatgtccttgaaggcccgtacatggtcaaggatcttgcaagc
taa

DBGET integrated database retrieval system