KEGG   Encephalitozoon hellem: EHEL_100660Help
Entry
EHEL_100660       CDS       T02287                                 

Definition
MYST histone acetyltransferase
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
ehe  Encephalitozoon hellem
Brite
Enzymes [BR:ehe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     EHEL_100660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
X:complement(79954..81087)
Genome map
AA seq 377 aa AA seqDB search
MRLEDIHVGFKVPVKKIVNATEEIYKAEILGRREGQSGLEFYVHYMELNRRLDEWVDGSM
VDLSDPSQIEIPKKKKTEKTKAEKSRRASEKEDGMKEEEPKLERPPQDEEFRMKNVKKIM
LRNHLVDAWYFSPYPKAIAESDIVYICEFCLYYFNTMDNLVLHAKQCKLRHPPGREIYRD
GNLSFFECDGHIQKNYCRNLSLLSKLFLDHKSLYYDVDVFMFYVLCRLEDNGYQIVGYFS
KEKMSEQGYNLACILTLPFEQRKGYGKILIDFSYLLSKRDNMISGPEKPLSDLGLLSYRT
YWMEVIVEYLSRHSKASIAEISKETHISEDDIVGTLSAYKMLRIDGNEFIFTYDERQLQK
AQRSRSKCVNGSLLKLC
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaggcttgaggatattcatgtaggattcaaggttcctgttaagaagattgtaaatgcg
acggaagagatatataaagcggagattctggggagaagagaaggccagtctgggcttgag
ttctatgtacactatatggagctaaacagaaggcttgacgaatgggtcgatggatccatg
gtagatctgagcgatccaagccagatagagattccaaagaagaagaagacggaaaaaacg
aaggcagagaagtcgagaagagcctctgaaaaggaggacgggatgaaagaggaggagccc
aagctggagaggccgccgcaagatgaggagttcagaatgaagaatgtcaagaagatcatg
cttcgaaatcaccttgttgatgcctggtacttctcgccgtatccaaaggcaatagcagag
agtgacattgtttacatatgcgagttttgcttgtattacttcaacacaatggataaccta
gttctgcatgcaaagcaatgcaaactccgccatccaccaggcagggaaatctatcgggat
ggaaacctgagcttttttgagtgcgatgggcacatacaaaagaattactgtagaaaccta
tcgttgttgtcaaagttgtttctggaccataagtctctttactatgacgtagatgtgttt
atgttctatgtgctttgtagacttgaagacaacgggtaccagatagtgggatacttttca
aaggagaagatgtcggagcaaggatacaaccttgcatgcattctgacactcccctttgag
caaagaaaaggatatggaaagattctgatagacttttcctatcttcttagcaaaagagat
aatatgatttccggaccggaaaagcctttgagcgatctcgggctgctcagctacagaaca
tattggatggaggtgattgtcgagtacttatcaagacatagcaaagcaagcattgcagag
atttctaaggaaacccacatatccgaggatgacatagtaggaactctttctgcatataag
atgctgaggatagacgggaacgagtttattttcacatatgacgagaggcagctccaaaag
gcccaaaggtccagaagcaagtgtgtgaacggatctcttcttaagttatgctga

DBGET integrated database retrieval system