KEGG   Encephalitozoon hellem: EHEL_101450Help
Entry
EHEL_101450       CDS       T02287                                 

Definition
chromatin remodeling transcription factor
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ehe  Encephalitozoon hellem
Brite
Enzymes [BR:ehe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     EHEL_101450
Transcription machinery [BR:ehe03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     EHEL_101450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
X:complement(192462..193652)
Genome map
AA seq 396 aa AA seqDB search
MNLFGLGSNHTQKDGNEMCQKFRDGDLRAAIVSSSDPQADRMLLLGLKCLFQRQLSRMPR
EYILRQVFDSKHASMALINSAKEVVGGICYRPFFEQGFVEIVFLAVDYDFQVKGVGGFMM
DLFKEVIKEEVKSCRWKLADDVLGIYEHKYRTIEDLGPLLAKAPECGARPLYLVTYADNF
AIGYFRKQGFSTEIRFGGWIGFIKDYEGGTIVECHVFWEINYLRKQEIIRDMKRKLLEEM
KKINTYHVVHKIDDYSNIKSIGDIPGVLDAKGSDEEDSDMRRQARFISYLISDLRMNAHA
WPFLKPVDPTEVPDYYKRISNPMDLSTMASKLKGNEYKYIEAFIDDVNLMVNNCLTYNGR
DTQYYKCAQMLLAHFNKRLEFYKHVIDRLPKRREAK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaatctttttggattggggagcaatcatactcaaaaggatggaaatgagatgtgccag
aaattcagagacggcgatctaagggcagccatagtgtcttcttcagatccacaggcagac
aggatgcttctccttggacttaaatgtctgttccagaggcagctgtcgaggatgcccagg
gagtacattcttaggcaagtgtttgactccaagcatgccagcatggcgctgataaactct
gcaaaggaggttgtggggggaatatgctacaggccgttctttgagcagggctttgtagag
attgtgtttctggctgttgactacgacttccaagtgaagggagttggcgggtttatgatg
gatcttttcaaggaggttatcaaggaagaagtgaaaagctgcaggtggaagttggcggac
gacgttctcggaatctacgagcacaagtacaggaccattgaagacctcggcccgcttcta
gccaaagcacccgagtgcggtgcaaggcctctttatttggtaacgtatgcagacaacttt
gcaataggatacttcaggaagcaaggtttttctaccgaaataaggtttggaggatggatt
gggttcattaaggattacgagggaggcaccatagttgagtgccatgtcttttgggagatc
aattatctgaggaagcaggagattattagggacatgaagagaaagctgctggaagaaatg
aagaaaatcaacacctatcatgtagttcacaagatagacgactactcgaatattaagagc
attggagacatcccgggcgtcctggatgctaagggttctgatgaggaagatagtgacatg
aggcggcaagccaggtttatttcgtatcttatatctgatctccggatgaatgcgcatgcc
tggccatttctgaagcctgtggatcctacagaggttcctgactactacaagcgtatatcc
aatcctatggatctgtccaccatggcgtccaaactaaaaggcaacgagtacaaatacata
gaggcatttatcgatgatgtgaacttgatggtaaataactgtcttacgtacaatggcaga
gatacacagtactacaagtgtgcacagatgctcctggcgcacttcaacaaaaggcttgag
ttttacaaacatgtcattgatagactcccaaagagaagagaggccaagtga

DBGET integrated database retrieval system