KEGG   Encephalitozoon hellem: EHEL_101630Help
Entry
EHEL_101630       CDS       T02287                                 

Definition
choline-phosphate cytidylyltransferase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
ehe  Encephalitozoon hellem
Pathway
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ehe00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    EHEL_101630
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    EHEL_101630
Enzymes [BR:ehe01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     EHEL_101630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
X:complement(209046..209882)
Genome map
AA seq 278 aa AA seqDB search
MEKEDSVEEYKIMAPTYPDRNAFEYEEMTSDVGMYKIPVNRPVRIYCDGVYDLFHYGHAR
SLKQAKNLFPNVYLLVGVTDDDITTRLKGNLVMNEKERAEGLIHCRYVDEVITSAPWELT
SEFLQKHRIDFVAHDDIPYKGEGKEDIYKFVKDMGMFIPIRRTKGISTSGIITNIVRNYD
MYVRRNLERGVSAKDLNISFLHMKRIKVSKKMNEMIKNVDIQREIDDIRREIRIAMKYWE
RVSNEIISGFIENFYHGNASGKFIDRLVEFVKLKRKAE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaggaggatagtgtagaggagtacaagattatggcgcctacatacccagacaga
aatgcatttgagtacgaggagatgacttccgatgttggcatgtataagataccggtcaac
aggcctgttcgaatatactgcgatggggtgtacgatctgttccattatgggcatgccagg
agcctgaagcaggcaaagaacctctttccgaatgtttacctgctggttggtgttaccgac
gacgacataacaacaaggctcaagggaaaccttgttatgaatgaaaaagaaagggcagag
gggcttatacactgcagatatgttgacgaggttataacaagtgcgccgtgggagctaaca
tcagaattccttcaaaagcataggatagactttgttgcgcatgacgacataccgtataag
ggagagggcaaggaagacatctacaagtttgtgaaggacatggggatgttcataccgatc
agaagaacaaaaggaatcagcacaagcgggataataacgaacatcgttcggaactacgac
atgtatgtcaggaggaatcttgaaaggggggtttctgcaaaggacctgaacatatcgttt
cttcacatgaagagaataaaggtgagcaagaagatgaacgagatgatcaagaacgtcgat
attcagagggagattgacgatataaggagagagatacggattgcaatgaagtactgggag
agggtgtccaacgagattatttctggctttatagagaatttttatcacggaaatgcttcc
ggcaagttcattgatcgcctggtggagtttgtgaagctcaagagaaaggccgagtag

DBGET integrated database retrieval system