KEGG   Encephalitozoon hellem: EHEL_110060Help
Entry
EHEL_110060       CDS       T02287                                 

Definition
(RefSeq) protein kinase domain-containing protein
  KO
K18670  
dual specificity protein kinase YAK1 [EC:2.7.12.1]
Organism
ehe  Encephalitozoon hellem
Brite
Enzymes [BR:ehe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     EHEL_110060
Protein kinases [BR:ehe01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   EHEL_110060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
XI:complement(4222..5439)
Genome map
AA seq 405 aa AA seqDB search
MDKKVLTFPSEKVGLSPDNAEFDLVMARGDYLSKNKNQKYMVIGMLGTGTFGQVVRCVGP
DGEEVAIKVVKNQPKYYNYEMNEVRILHKLLYNNLNDRFVAIKDVFMYKQHLCIVEELLG
RNLYTFLKMTRFKGLDHSTVRTILQQVLEGMIQLSILGIIHCDLKPENILIADYDTFKVK
IIDFGSAVTSPQGSHFYVQSRYYRAPEVILGIPYGSSCDVWSLGCIGYELYVGHPLFPGK
DNTDQIGRIYGLFGSLPMFMIEHGKNSSVFFEKENGYRFVGQPSSFTLEDMKKAIRSKDN
MQEDDDVFIEFLLRALEPSHLVRPDARSLSAHSYLKIKDRGGDLCRAPSSRNGVQQSTLP
SSKSIRHMSTTGVILPSKKQKPSDDRRKISVYGISYENNLNRDTE
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaaaagttttgacttttccatctgagaaggtaggcctgtctccagacaacgca
gagtttgatcttgtaatggctagaggagattatctgtcaaaaaacaaaaaccagaaatac
atggtcattggtatgctagggacggggaccttcggtcaggtggttaggtgtgtcggacct
gatggcgaagaagttgcaattaaggtggtgaagaatcagccaaagtattataactacgaa
atgaacgaagttagaattcttcataagctgctttacaacaacttaaatgacagatttgta
gccattaaggatgtattcatgtataaacaacatctatgcattgtagaagagttacttgga
agaaatctttacacattcttgaaaatgacaagatttaagggcctggatcattctacggtt
agaactatacttcagcaagtacttgaaggaatgatccagctttcaatactaggaatcatc
cattgcgacttaaagccagagaatattctcatagctgattatgacactttcaaggtgaag
ataattgactttgggtcagcagttacctctccccagggatcacacttttatgttcaatcg
agatattatcgtgcacctgaagtcatccttgggattccgtatggatcaagctgtgatgta
tggtctcttgggtgcataggatacgagctgtatgttgggcacccgttgtttccgggaaag
gataacacagaccaaataggaaggatctacgggctgtttgggtcgctccctatgttcatg
atagagcatggaaagaactcgagtgtcttctttgagaaggaaaacggatacagattcgtg
ggacagccatccagctttaccttagaggacatgaagaaggcgataaggtcgaaggataac
atgcaggaggatgacgatgtattcatagagtttttgctgagggcattggagcctagccac
ctggtgaggccggatgctaggtcgttgtcggcccactcgtatctcaagatcaaggaccgt
gggggagacctctgcagggcaccctcgagcaggaacggagtgcagcagagcactcttccg
tcgagtaaaagcataaggcacatgtccacaactggtgtgattcttcccagtaagaagcag
aagccaagcgatgacaggaggaagatatcggtttacgggatttcgtatgaaaacaatcta
aacagggacaccgagtga

DBGET integrated database retrieval system