KEGG   Encephalitozoon hellem: EHEL_110060Help
Entry
EHEL_110060       CDS       T02287                                 

Definition
protein kinase domain-containing protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
ehe  Encephalitozoon hellem
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
XI:complement(4222..5439)
Genome map
AA seq 405 aa AA seqDB search
MDKKVLTFPSEKVGLSPDNAEFDLVMARGDYLSKNKNQKYMVIGMLGTGTFGQVVRCVGP
DGEEVAIKVVKNQPKYYNYEMNEVRILHKLLYNNLNDRFVAIKDVFMYKQHLCIVEELLG
RNLYTFLKMTRFKGLDHSTVRTILQQVLEGMIQLSILGIIHCDLKPENILIADYDTFKVK
IIDFGSAVTSPQGSHFYVQSRYYRAPEVILGIPYGSSCDVWSLGCIGYELYVGHPLFPGK
DNTDQIGRIYGLFGSLPMFMIEHGKNSSVFFEKENGYRFVGQPSSFTLEDMKKAIRSKDN
MQEDDDVFIEFLLRALEPSHLVRPDARSLSAHSYLKIKDRGGDLCRAPSSRNGVQQSTLP
SSKSIRHMSTTGVILPSKKQKPSDDRRKISVYGISYENNLNRDTE
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaaaagttttgacttttccatctgagaaggtaggcctgtctccagacaacgca
gagtttgatcttgtaatggctagaggagattatctgtcaaaaaacaaaaaccagaaatac
atggtcattggtatgctagggacggggaccttcggtcaggtggttaggtgtgtcggacct
gatggcgaagaagttgcaattaaggtggtgaagaatcagccaaagtattataactacgaa
atgaacgaagttagaattcttcataagctgctttacaacaacttaaatgacagatttgta
gccattaaggatgtattcatgtataaacaacatctatgcattgtagaagagttacttgga
agaaatctttacacattcttgaaaatgacaagatttaagggcctggatcattctacggtt
agaactatacttcagcaagtacttgaaggaatgatccagctttcaatactaggaatcatc
cattgcgacttaaagccagagaatattctcatagctgattatgacactttcaaggtgaag
ataattgactttgggtcagcagttacctctccccagggatcacacttttatgttcaatcg
agatattatcgtgcacctgaagtcatccttgggattccgtatggatcaagctgtgatgta
tggtctcttgggtgcataggatacgagctgtatgttgggcacccgttgtttccgggaaag
gataacacagaccaaataggaaggatctacgggctgtttgggtcgctccctatgttcatg
atagagcatggaaagaactcgagtgtcttctttgagaaggaaaacggatacagattcgtg
ggacagccatccagctttaccttagaggacatgaagaaggcgataaggtcgaaggataac
atgcaggaggatgacgatgtattcatagagtttttgctgagggcattggagcctagccac
ctggtgaggccggatgctaggtcgttgtcggcccactcgtatctcaagatcaaggaccgt
gggggagacctctgcagggcaccctcgagcaggaacggagtgcagcagagcactcttccg
tcgagtaaaagcataaggcacatgtccacaactggtgtgattcttcccagtaagaagcag
aagccaagcgatgacaggaggaagatatcggtttacgggatttcgtatgaaaacaatcta
aacagggacaccgagtga

DBGET integrated database retrieval system