KEGG   Encephalitozoon hellem: EHEL_111040Help
Entry
EHEL_111040       CDS       T02287                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
ehe  Encephalitozoon hellem
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ehe00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    EHEL_111040
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    EHEL_111040
   04113 Meiosis - yeast
    EHEL_111040
Protein phosphatases and associated proteins [BR:ehe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     EHEL_111040
Ubiquitin system [BR:ehe04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     EHEL_111040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
XI:complement(119183..120610)
Genome map
AA seq 475 aa AA seqDB search
MDARLIGKICKSIRYRDYETAIFLTAYLTQQKPEYRTLMSIVLYLNGEYSRALFHLHRLN
TCTSKYYESLCYKKKKDYKKAIKSLEHILEGKVERDPEVDARIQEMFIDPDDDEFFESLL
GDLYTLSGHREEAIGHYTKSFAKSFLFSAVENLLLENKIPLKRDKENIRQMGKRGIEEEY
VADIIEFHESLGQSLIKKYLEHVPGVGSYFISNAARRYFNLGMNDKSKACFELVRRKDPM
FLHNVDYYSTILWHCKDVYELGMLCKNLIKHAQDSPHTWKALGNFYSHQGDYQRSVLCFK
RSLHIEEDSYTYTLLGYESIQRNEYDIAMKYFNLSLKMLGDNYRAMFGCGLVYTKTERLD
NAEYFLKKAIETNPGNLQIKVHAMKFYTRKGLTDQSIRLFKEAFCMKYTDIHKIVECIIS
RKGSFSNVEEFLVLEFVEILVLQNLSKLAADVLSCVEYRGESYSKKKELLQDRIE
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggacgcaaggttaattggaaagatatgcaagtcgataagatacagggactatgagact
gcaatttttctaacggcatatctgactcagcaaaagcctgagtacagaacgctgatgtcc
atagtgctttatctgaacggggagtactcccgtgcgctctttcatctccacaggctcaac
acatgcacatctaaatactacgagtctctttgctacaaaaagaaaaaggactacaagaag
gcgatcaaaagcctggagcacattctcgagggaaaggttgaaagagaccccgaggtagat
gcaaggatacaagagatgtttattgatcctgacgatgatgagttttttgagtctcttctt
ggagacctgtatactttgtctgggcatcgagaagaagcgattgggcactacacaaagtcc
tttgcaaagagctttttgttttctgctgttgaaaaccttctgcttgagaacaagattcct
ctgaagagagacaaggagaacatccggcagatggggaagagggggatagaggaggagtat
gtggcagacatcattgagttccatgagagccttgggcagtctctgataaagaagtatttg
gagcatgtccctggagttggatcatacttcatttcaaatgcagcaaggaggtacttcaat
cttggaatgaatgataagagtaaggcatgctttgagcttgtaaggagaaaggatcccatg
tttttacacaacgtggactactactcgaccatcctgtggcactgcaaggatgtttatgag
ctcggaatgctgtgcaagaatctgatcaagcatgcacaggactctcctcacacatggaag
gcattagggaacttctatagccaccaaggggattaccaaaggagcgttctgtgtttcaag
agaagcctgcacatagaagaagattcatacacgtatacgcttctggggtatgaatcaatc
cagaggaacgaatatgacatagcaatgaagtactttaatctgtcactaaagatgcttgga
gacaactacagagcaatgtttggatgtggactggtgtacaccaagacagaaaggctagat
aatgcagagtattttctgaagaaggccatagagacaaatccaggaaaccttcaaatcaag
gtccatgcaatgaagttctacacaaggaaggggcttaccgaccagtcgataaggctcttc
aaggaggcgttctgtatgaagtacacagacattcacaagattgttgagtgcattatatcg
agaaagggaagcttcagcaatgttgaagagttcttagtccttgagtttgtagagattctt
gttctccagaatttgtccaagcttgcggcagatgtcctgagctgtgtggagtataggggg
gagtcttatagtaaaaagaaagagcttcttcaggataggatagaatga

DBGET integrated database retrieval system