KEGG   Encephalitozoon hellem: EHEL_111040Help
Entry
EHEL_111040       CDS       T02287                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
ehe  Encephalitozoon hellem
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:ehe04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:ehe04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:ehe04113]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
XI:complement(119183..120610)
Genome map
AA seq 475 aa AA seqDB search
MDARLIGKICKSIRYRDYETAIFLTAYLTQQKPEYRTLMSIVLYLNGEYSRALFHLHRLN
TCTSKYYESLCYKKKKDYKKAIKSLEHILEGKVERDPEVDARIQEMFIDPDDDEFFESLL
GDLYTLSGHREEAIGHYTKSFAKSFLFSAVENLLLENKIPLKRDKENIRQMGKRGIEEEY
VADIIEFHESLGQSLIKKYLEHVPGVGSYFISNAARRYFNLGMNDKSKACFELVRRKDPM
FLHNVDYYSTILWHCKDVYELGMLCKNLIKHAQDSPHTWKALGNFYSHQGDYQRSVLCFK
RSLHIEEDSYTYTLLGYESIQRNEYDIAMKYFNLSLKMLGDNYRAMFGCGLVYTKTERLD
NAEYFLKKAIETNPGNLQIKVHAMKFYTRKGLTDQSIRLFKEAFCMKYTDIHKIVECIIS
RKGSFSNVEEFLVLEFVEILVLQNLSKLAADVLSCVEYRGESYSKKKELLQDRIE
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggacgcaaggttaattggaaagatatgcaagtcgataagatacagggactatgagact
gcaatttttctaacggcatatctgactcagcaaaagcctgagtacagaacgctgatgtcc
atagtgctttatctgaacggggagtactcccgtgcgctctttcatctccacaggctcaac
acatgcacatctaaatactacgagtctctttgctacaaaaagaaaaaggactacaagaag
gcgatcaaaagcctggagcacattctcgagggaaaggttgaaagagaccccgaggtagat
gcaaggatacaagagatgtttattgatcctgacgatgatgagttttttgagtctcttctt
ggagacctgtatactttgtctgggcatcgagaagaagcgattgggcactacacaaagtcc
tttgcaaagagctttttgttttctgctgttgaaaaccttctgcttgagaacaagattcct
ctgaagagagacaaggagaacatccggcagatggggaagagggggatagaggaggagtat
gtggcagacatcattgagttccatgagagccttgggcagtctctgataaagaagtatttg
gagcatgtccctggagttggatcatacttcatttcaaatgcagcaaggaggtacttcaat
cttggaatgaatgataagagtaaggcatgctttgagcttgtaaggagaaaggatcccatg
tttttacacaacgtggactactactcgaccatcctgtggcactgcaaggatgtttatgag
ctcggaatgctgtgcaagaatctgatcaagcatgcacaggactctcctcacacatggaag
gcattagggaacttctatagccaccaaggggattaccaaaggagcgttctgtgtttcaag
agaagcctgcacatagaagaagattcatacacgtatacgcttctggggtatgaatcaatc
cagaggaacgaatatgacatagcaatgaagtactttaatctgtcactaaagatgcttgga
gacaactacagagcaatgtttggatgtggactggtgtacaccaagacagaaaggctagat
aatgcagagtattttctgaagaaggccatagagacaaatccaggaaaccttcaaatcaag
gtccatgcaatgaagttctacacaaggaaggggcttaccgaccagtcgataaggctcttc
aaggaggcgttctgtatgaagtacacagacattcacaagattgttgagtgcattatatcg
agaaagggaagcttcagcaatgttgaagagttcttagtccttgagtttgtagagattctt
gttctccagaatttgtccaagcttgcggcagatgtcctgagctgtgtggagtataggggg
gagtcttatagtaaaaagaaagagcttcttcaggataggatagaatga

DBGET integrated database retrieval system