KEGG   Encephalitozoon hellem: EHEL_111430Help
Entry
EHEL_111430       CDS       T02287                                 

Definition
(RefSeq) hexokinase
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
ehe  Encephalitozoon hellem
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ehe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EHEL_111430
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EHEL_111430
   00051 Fructose and mannose metabolism
    EHEL_111430
   00052 Galactose metabolism
    EHEL_111430
   00500 Starch and sucrose metabolism
    EHEL_111430
   00520 Amino sugar and nucleotide sugar metabolism
    EHEL_111430
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    EHEL_111430
Enzymes [BR:ehe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     EHEL_111430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
XI:169719..171083
Genome map
AA seq 454 aa AA seqDB search
MLFTAKRTEAIVALIVGTFGIWPSVNGKEAGNQASSFPIQKLEIQEIKKAFTERITKAQK
SNSDGDFLRSHIDLNKARTKYRGCCTFVVIDVGGTHLKIGEILIDLGSKKENGALCFDSI
VECSPSLYKYPDTSKIPNEDRMTWNEWVAEKIGEFYGQESPERSIDACLTFSYPLTQTSI
NNATIERVTKNFCFKVDENTFKVNVVEALNSSLKNRSINVHVNCVVNDSTATYMAGMLRG
YDNIIGIVLGTGTNSSFCVKKESGEDVLYNSEWGSTNVPRSALTEADLAVITDLEMKKAS
YNIVDILAGGCKLSEIVLNRLKNLHPEMYEEYAGRKEYLCSMIRSAISRSSKDILEEDFK
LYRTLVSMVDHFNTRGTKILGSMISAIIDSCMGNMGHVTLILNGTAFSNMKLRNAFEIEV
QCMYPSIGINFVFLGNASLEGSAFVSFIHSNNVE
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgctttttactgcaaaaaggacggaagcaattgtagctcttatagtcgggacatttggc
atatggccttctgtgaatggaaaggaggcgggcaatcaggccagctcgtttcctatccag
aagctcgagatccaagagataaaaaaggcttttactgaaaggatcacaaaagctcaaaaa
agtaattctgatggagatttcctaaggtctcatattgatctgaataaggcaagaactaaa
taccggggatgctgcacatttgtggttattgatgttggggggacacatttaaagataggt
gagattctaattgaccttggatctaaaaaagagaacggcgccttatgttttgacagtatt
gtggaatgtagtccatctctttacaagtatccggacacttccaagattccgaatgaagat
agaatgacttggaatgaatgggttgcagagaagatcggtgagttctatgggcaagagtct
ccagaaagaagcatcgatgcatgcctgacattctcatatccccttactcagacatcgatt
aacaatgcaacaatagagagagtgacaaagaacttctgctttaaggtagacgaaaacaca
ttcaaagtgaatgtagttgaagcccttaattcttctctgaaaaacagaagcatcaacgtc
cacgttaactgcgttgtaaatgactccacggcaacatacatggcaggcatgcttcgagga
tatgataacataattgggatcgttctgggaacggggacgaattcttctttctgtgtcaag
aaggagagcggagaggatgtgctatacaactctgagtggggatctacaaatgtgccgaga
agtgctctgacggaagcggatcttgctgtgattacagacctcgagatgaagaaggcttct
tataacatcgttgatatcctagcaggaggctgcaagctcagcgaaatagttttgaatagg
cttaagaacttacacccagaaatgtatgaggagtatgcagggaggaaagaatatctatgc
tccatgatacgctcagcaatctcgagatcaagtaaggacattcttgaggaggattttaaa
ctctacagaacattggtttctatggtcgatcactttaatactagggggacgaagatacta
ggatctatgataagtgccataatcgattcttgcatggggaatatggggcatgtcaccctg
atcctgaatggaacggcattttcaaacatgaagcttagaaatgcttttgaaatcgaggtg
caatgcatgtacccatctattggaattaatttcgtgttccttggaaatgcatctctagag
ggctctgcgttcgtgtctttcatccattcaaacaatgttgagtaa

DBGET integrated database retrieval system