KEGG   Encephalitozoon hellem: EHEL_111430Help
Entry
EHEL_111430       CDS       T02287                                 

Definition
hexokinase
Orthology
K00844  
hexokinase [EC:2.7.1.1]
Organism
ehe  Encephalitozoon hellem
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ehe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EHEL_111430
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EHEL_111430
   00051 Fructose and mannose metabolism
    EHEL_111430
   00052 Galactose metabolism
    EHEL_111430
   00500 Starch and sucrose metabolism
    EHEL_111430
   00520 Amino sugar and nucleotide sugar metabolism
    EHEL_111430
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    EHEL_111430
Enzymes [BR:ehe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     EHEL_111430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
XI:169719..171083
Genome map
AA seq 454 aa AA seqDB search
MLFTAKRTEAIVALIVGTFGIWPSVNGKEAGNQASSFPIQKLEIQEIKKAFTERITKAQK
SNSDGDFLRSHIDLNKARTKYRGCCTFVVIDVGGTHLKIGEILIDLGSKKENGALCFDSI
VECSPSLYKYPDTSKIPNEDRMTWNEWVAEKIGEFYGQESPERSIDACLTFSYPLTQTSI
NNATIERVTKNFCFKVDENTFKVNVVEALNSSLKNRSINVHVNCVVNDSTATYMAGMLRG
YDNIIGIVLGTGTNSSFCVKKESGEDVLYNSEWGSTNVPRSALTEADLAVITDLEMKKAS
YNIVDILAGGCKLSEIVLNRLKNLHPEMYEEYAGRKEYLCSMIRSAISRSSKDILEEDFK
LYRTLVSMVDHFNTRGTKILGSMISAIIDSCMGNMGHVTLILNGTAFSNMKLRNAFEIEV
QCMYPSIGINFVFLGNASLEGSAFVSFIHSNNVE
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgctttttactgcaaaaaggacggaagcaattgtagctcttatagtcgggacatttggc
atatggccttctgtgaatggaaaggaggcgggcaatcaggccagctcgtttcctatccag
aagctcgagatccaagagataaaaaaggcttttactgaaaggatcacaaaagctcaaaaa
agtaattctgatggagatttcctaaggtctcatattgatctgaataaggcaagaactaaa
taccggggatgctgcacatttgtggttattgatgttggggggacacatttaaagataggt
gagattctaattgaccttggatctaaaaaagagaacggcgccttatgttttgacagtatt
gtggaatgtagtccatctctttacaagtatccggacacttccaagattccgaatgaagat
agaatgacttggaatgaatgggttgcagagaagatcggtgagttctatgggcaagagtct
ccagaaagaagcatcgatgcatgcctgacattctcatatccccttactcagacatcgatt
aacaatgcaacaatagagagagtgacaaagaacttctgctttaaggtagacgaaaacaca
ttcaaagtgaatgtagttgaagcccttaattcttctctgaaaaacagaagcatcaacgtc
cacgttaactgcgttgtaaatgactccacggcaacatacatggcaggcatgcttcgagga
tatgataacataattgggatcgttctgggaacggggacgaattcttctttctgtgtcaag
aaggagagcggagaggatgtgctatacaactctgagtggggatctacaaatgtgccgaga
agtgctctgacggaagcggatcttgctgtgattacagacctcgagatgaagaaggcttct
tataacatcgttgatatcctagcaggaggctgcaagctcagcgaaatagttttgaatagg
cttaagaacttacacccagaaatgtatgaggagtatgcagggaggaaagaatatctatgc
tccatgatacgctcagcaatctcgagatcaagtaaggacattcttgaggaggattttaaa
ctctacagaacattggtttctatggtcgatcactttaatactagggggacgaagatacta
ggatctatgataagtgccataatcgattcttgcatggggaatatggggcatgtcaccctg
atcctgaatggaacggcattttcaaacatgaagcttagaaatgcttttgaaatcgaggtg
caatgcatgtacccatctattggaattaatttcgtgttccttggaaatgcatctctagag
ggctctgcgttcgtgtctttcatccattcaaacaatgttgagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system