KEGG   Entamoeba histolytica: EHI_000440Help
Entry
EHI_000440        CDS       T00238                                 

Gene name
106.t00014
Definition
(RefSeq) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ehi  Entamoeba histolytica
Pathway
ehi00040  Pentose and glucuronate interconversions
ehi00052  Galactose metabolism
ehi00500  Starch and sucrose metabolism
ehi00520  Amino sugar and nucleotide sugar metabolism
ehi01100  Metabolic pathways
ehi01130  Biosynthesis of antibiotics
Module
ehi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EHI_000440 (106.t00014)
   00052 Galactose metabolism
    EHI_000440 (106.t00014)
   00500 Starch and sucrose metabolism
    EHI_000440 (106.t00014)
   00520 Amino sugar and nucleotide sugar metabolism
    EHI_000440 (106.t00014)
Enzymes [BR:ehi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EHI_000440 (106.t00014)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP YcgL SapB_1
Motif
Other DBs
NCBI-GeneID: 3407065
NCBI-ProteinID: XP_652750
UniProt: C4LZ95
AA seq 474 aa AA seqDB search
MNTQEIRTKTEEIIQHLLQQGASEDDTKNLKSFQILHNAYLEQIDKKTTGIEWDKVESLP
KEFSVDYSTLDKDFTKEEIIELLKKTCIIKINGGLGTSMGCTGPKSVIEVRNGLTFLDII
ILQLKALYREYGVVVPLVLMNSFSTNVETEKVIKKYEQDNDVRILTFLQHKFPRIDAQTL
LPVCTELNGRKEEWYPPGHGDFLQSFVDSKAFQTLKEEGKEYLFLSNSDNLGAIPDITIM
HHFSKNHLDFALELTPKTLNDVKGGTLIRYGNKLKMLEIAQVPSEHVAEFKDIKKFKVFN
TNNIWMNMSAIQHVVEKRTLLNNMDIIVNRKKDGQRDVIQLEIAVGCAVSAFEHTTAYIV
PRSRFLPVKACNDLFIIQSTLFGLNESGHMVDNARKVSDIPPSVTFSKDFQFISEYQKHM
QHIPNIEHLNSLVVDGNIVFGKNVKLVGDVVLKNTTTKPILLEDKTIENTTLTF
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaatacccaagagatcagaacaaagactgaagaaattatccaacaccttcttcaacaa
ggagccagtgaagatgatactaagaatttaaagtcattccaaattcttcataatgcttat
cttgaacaaatagataaaaagactactggtattgaatgggacaaagttgaatcacttcca
aaagagttttctgtagattacagcacattagataaagattttacaaaagaagagattata
gaattattaaagaaaacttgtattattaagatcaatggaggattaggaacatctatggga
tgtactggtccaaaaagtgtaattgaagttagaaatggattaacattcttagatattata
atacttcaattaaaagcattatatcgtgaatatggagttgttgttccattagttcttatg
aattctttttctacaaatgttgaaacagagaaggttattaaaaaatatgaacaagataat
gatgtaagaatattaactttcttacaacataaatttccaagaattgatgcacaaactctt
cttcctgtatgtactgaattaaatggaagaaaagaagaatggtatccaccaggacatgga
gactttttacaatcatttgttgattccaaagcattccaaaccttaaaagaagaaggaaaa
gaatatttattcttatcaaattcagataatcttggtgctattcctgatattactattatg
catcatttttctaaaaatcatttagattttgctttagaattaactccaaaaactttaaat
gatgttaaaggaggtactcttattagatatggtaataaattaaaaatgttagaaattgca
caagttccaagtgaacatgttgcagaatttaaagatattaagaaatttaaagtatttaat
accaataatatttggatgaatatgtcagctattcaacatgttgttgaaaaaagaacatta
ttaaataatatggatattattgttaatcgtaaaaaagatggacaaagagatgtcattcaa
ttagaaattgcagttggatgtgcagtaagtgcatttgaacatacaacagcatatattgtt
ccaagatcaagattccttccagtaaaagcatgtaatgatttatttattattcaaagtaca
ttatttggattaaatgaatcaggtcatatggttgataatgctagaaaagtatcagatatt
ccaccatcagttacatttagtaaagatttccaatttattagtgaatatcaaaaacatatg
caacatattcctaatattgaacatctcaactcacttgttgttgatggaaatatagttttt
ggaaaaaatgttaagttggtaggtgatgtagtattaaaaaatactacaactaaacctatt
ttattggaagataagactatagaaaatactacattaacattctaa

DBGET integrated database retrieval system