KEGG   Entamoeba histolytica: EHI_000440Help
Entry
EHI_000440        CDS       T00238                                 

Gene name
106.t00014
Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ehi  Entamoeba histolytica
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EHI_000440 (106.t00014)
   00052 Galactose metabolism
    EHI_000440 (106.t00014)
   00500 Starch and sucrose metabolism
    EHI_000440 (106.t00014)
   00520 Amino sugar and nucleotide sugar metabolism
    EHI_000440 (106.t00014)
Enzymes [BR:ehi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EHI_000440 (106.t00014)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 474 aa AA seqDB search
MNTQEIRTKTEEIIQHLLQQGASEDDTKNLKSFQILHNAYLEQIDKKTTGIEWDKVESLP
KEFSVDYSTLDKDFTKEEIIELLKKTCIIKINGGLGTSMGCTGPKSVIEVRNGLTFLDII
ILQLKALYREYGVVVPLVLMNSFSTNVETEKVIKKYEQDNDVRILTFLQHKFPRIDAQTL
LPVCTELNGRKEEWYPPGHGDFLQSFVDSKAFQTLKEEGKEYLFLSNSDNLGAIPDITIM
HHFSKNHLDFALELTPKTLNDVKGGTLIRYGNKLKMLEIAQVPSEHVAEFKDIKKFKVFN
TNNIWMNMSAIQHVVEKRTLLNNMDIIVNRKKDGQRDVIQLEIAVGCAVSAFEHTTAYIV
PRSRFLPVKACNDLFIIQSTLFGLNESGHMVDNARKVSDIPPSVTFSKDFQFISEYQKHM
QHIPNIEHLNSLVVDGNIVFGKNVKLVGDVVLKNTTTKPILLEDKTIENTTLTF
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaatacccaagagatcagaacaaagactgaagaaattatccaacaccttcttcaacaa
ggagccagtgaagatgatactaagaatttaaagtcattccaaattcttcataatgcttat
cttgaacaaatagataaaaagactactggtattgaatgggacaaagttgaatcacttcca
aaagagttttctgtagattacagcacattagataaagattttacaaaagaagagattata
gaattattaaagaaaacttgtattattaagatcaatggaggattaggaacatctatggga
tgtactggtccaaaaagtgtaattgaagttagaaatggattaacattcttagatattata
atacttcaattaaaagcattatatcgtgaatatggagttgttgttccattagttcttatg
aattctttttctacaaatgttgaaacagagaaggttattaaaaaatatgaacaagataat
gatgtaagaatattaactttcttacaacataaatttccaagaattgatgcacaaactctt
cttcctgtatgtactgaattaaatggaagaaaagaagaatggtatccaccaggacatgga
gactttttacaatcatttgttgattccaaagcattccaaaccttaaaagaagaaggaaaa
gaatatttattcttatcaaattcagataatcttggtgctattcctgatattactattatg
catcatttttctaaaaatcatttagattttgctttagaattaactccaaaaactttaaat
gatgttaaaggaggtactcttattagatatggtaataaattaaaaatgttagaaattgca
caagttccaagtgaacatgttgcagaatttaaagatattaagaaatttaaagtatttaat
accaataatatttggatgaatatgtcagctattcaacatgttgttgaaaaaagaacatta
ttaaataatatggatattattgttaatcgtaaaaaagatggacaaagagatgtcattcaa
ttagaaattgcagttggatgtgcagtaagtgcatttgaacatacaacagcatatattgtt
ccaagatcaagattccttccagtaaaagcatgtaatgatttatttattattcaaagtaca
ttatttggattaaatgaatcaggtcatatggttgataatgctagaaaagtatcagatatt
ccaccatcagttacatttagtaaagatttccaatttattagtgaatatcaaaaacatatg
caacatattcctaatattgaacatctcaactcacttgttgttgatggaaatatagttttt
ggaaaaaatgttaagttggtaggtgatgtagtattaaaaaatactacaactaaacctatt
ttattggaagataagactatagaaaatactacattaacattctaa

DBGET integrated database retrieval system