KEGG   Entamoeba histolytica: EHI_006130Help
Entry
EHI_006130        CDS       T00238                                 

Gene name
83.t00026
Definition
phosphatidylinositol 3-kinase
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
ehi  Entamoeba histolytica
Pathway
Inositol phosphate metabolism
Phosphatidylinositol signaling system
Amoebiasis
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:ehi00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:ehi04070]
Human Diseases; Infectious diseases; Amoebiasis [PATH:ehi05146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1047 aa AA seqDB search
MKKSVHSSVVNSQSQGSIVHVFIRHEGEIHSFTYSSTVSPLDIIDSIKSTLHLTGVYSVV
VPNIPFKIVDSMEGSEVKETGFYKSCTEYGIIPAFELIERSQAEKYESVGILAKLMNQLK
ENYQIIGQTYVDVLNTDAEEIFVFRRSLARTRVLSSKIEAKYDSNLKEENEFAYTLSEPN
IPDTIKSIDVEIIGEDYKTTAIFSITPQVFVYRIIDSAFNELKKAGEGVVNGKEPSEYIL
KVVGWDEYIVPQRVNGKNWLLSDYDYIRRCALHGEAVHLELVKKSRLFSCKINDEERKVL
NYLDSFFASELWEAFDDEKRVSQRLCTDQLSAQVVSVENLCSYIKTKKGDEEEQQMITDF
LCYFKVELYYGEKSLCPALYSTVFEVKNGLASPKWKFTFIQLIATLPAETKMIYSVYMTN
SIVNTQIEKIGENDKCLGTVNTKIVNYTNDLLNGEQQYYLWASEPNPIAMCCNAVSSKMK
VVVEFPSLTKPIRMDTYITKKKEMQVELEQESEKKMTVEELDAFKKIVDADAMAVFTQEE
LKCLWERRYSLLKTNPHALARLLNSVNYCQPTEVHELHRLLSKWPLLDPREAIELLDFRY
PDPQIRGFALRCIDTMTDDQLVMYLPQLVQALKFELHHHSTLASFLLERSLKNRRRIGHN
LFWFLKAEIHDARVTGRYGVLMEAFLNGCGRYKNELEKEVTFQNQLVVIANEVKRLGTKD
EQKAHLKSSLAKLEYPDEMSLPLDARFRIKKPIPNTGNVFSSKKKPLMLVLENADPLGEP
IMVIQKVGDDLRQDILTLQMIRLMNTIWKNNGLDLCMLPYLCIATGNEIGMLELVKNSET
YGAIMAMDKSKFSVIKDTAVTTWLKEQCARPESQVTFQEAVENFTYSCAGYCVATYILGI
GDRHSDNVMISRDGKFFHIDFGHFLGNFKSKFGVKRERTPFKFTQHFANVLGGKGSPQFV
KFEEICMNAFVIIRKHGPLFIYLFRLMLATGIPELQSAKDIEYMRNMFMFDKNDDEAKEA
FRQLIYKCLDAWSQTVNDLIHDFVHYK
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtctgttcattcatcagtagttaattcacaatcacaagggtctattgttcat
gtgtttattcgacatgaaggagaaatacattcatttacatattcatctaccgtatcacca
cttgatattatagacagtattaaaagtacacttcatttgactggagtttatagtgttgtt
gttccaaacattccatttaagatagttgattctatggaaggttcagaagtgaaagagaca
gggttttataagtcatgtactgaatatggaattatcccagcctttgaactaattgagaga
agtcaagcagaaaaatatgagagtgttggaatattggcaaaattgatgaatcaattaaaa
gagaattatcaaattattggacaaacatatgttgatgtactaaatactgatgcagaagaa
atatttgtgtttagaagatcacttgcaagaacacgtgtattatcaagtaaaatagaagct
aaatacgattctaatttaaaagaagaaaatgagtttgcttatacattaagtgaacctaat
attcctgacactattaaaagtattgatgttgaaattattggagaagattataaaactaca
gctattttctcaattacaccacaagtatttgtttataggattattgacagtgcttttaat
gaattaaagaaagcaggagaaggtgtagttaatggaaaggaaccatcagaatatatctta
aaagtagttggatgggatgaatatattgtaccacaacgtgttaatggaaagaattggtta
ttgagtgattatgattatataagaagatgtgcattacatggagaagcagttcatttagaa
ttagttaaaaaaagtaggttattttcatgtaaaattaatgatgaagaaagaaaagtctta
aattatcttgactccttttttgcatcagaattatgggaagcatttgatgatgaaaaaaga
gtttcacaaaggctttgtacagaccaattaagtgcacaagttgtttctgtagagaattta
tgttcttatatcaaaacaaaaaaaggagatgaagaagaacaacaaatgattactgatttt
ctttgttattttaaagtagagttgtattatggagaaaagtcattatgtccagcattatat
tcaacagtttttgaagttaaaaatggactagcttctcctaaatggaaatttacttttatt
caattaattgctacactcccagctgaaacaaaaatgatttattcagtgtatatgactaat
tccatagttaatacccaaatagaaaagattggtgaaaatgataaatgtcttggaacagtg
aatacaaaaattgttaattatacaaatgatttattaaatggtgaacaacaatattattta
tgggcaagtgaaccaaatccaattgctatgtgttgtaatgcagtaagttcaaagatgaaa
gttgttgttgaatttccatcattaactaaaccaattcgaatggatacatatattactaag
aaaaaagaaatgcaagtagaattagaacaagaatcagaaaaaaagatgactgttgaagaa
ttagatgcatttaaaaaaatagttgatgctgatgctatggcagtatttactcaagaagaa
ttaaaatgtttatgggaaagaagatattcattattaaagacaaatccacatgcccttgct
cgtttattgaattctgtaaactattgccaaccaacagaagtacatgaattacataggtta
ttaagcaaatggccattattagatcctcgagaagctattgaattgctagattttagatac
ccagatcctcaaataagaggttttgctttacggtgtattgatactatgactgatgaccaa
ttagtaatgtatttacctcaactagttcaagcattaaaatttgagttacatcaccattct
acattagcctcatttttattggaaaggtcattaaagaatagaagaagaattggtcataat
ttgttttggtttttaaaagcagaaattcatgatgctagagttactggaagatatggtgtc
ttgatggaagcattcttaaatggatgtggaagatataaaaatgaattagagaaagaagtt
acattccaaaatcaattagttgttattgccaatgaagtaaaacgacttggaacaaaagat
gaacagaaagctcatttaaagagttcactagcaaaattagaatatcctgatgaaatgtct
ttaccattagatgcacgatttagaataaaaaaaccaattccaaatactggaaatgtattt
agtagtaaaaagaaaccattgatgttagtattggaaaatgcagatccattaggagaacca
attatggttattcaaaaagttggggatgatttaagacaagatatcttaactttacaaatg
attagattaatgaataccatttggaaaaataatggtcttgatttatgcatgttaccatat
ctttgtattgctacaggaaatgaaataggaatgttagaacttgttaaaaattcagaaacg
tatggagcaattatggctatggataaaagtaagtttagtgttattaaagatactgcagtg
actacttggcttaaggaacaatgtgccagaccagaaagtcaagtaacattccaagaagca
gtagaaaactttacttattcatgtgcaggatattgtgtagcaacatatattttaggtatt
ggagatagacatagtgacaatgtaatgattagtcgagatggtaaattcttccatattgac
tttggacattttcttggtaattttaaatcaaaatttggagttaaaagagaaagaacacca
tttaaatttactcaacattttgctaatgttcttggaggtaaagggtctccacaatttgtg
aaatttgaagaaatttgtatgaatgcttttgtcattataagaaaacatggtccattgttt
atttatttatttagactaatgcttgctacaggtattcctgaattacaaagtgctaaagat
attgaatatatgagaaatatgttcatgtttgataaaaatgatgatgaggctaaagaggca
tttagacaactcatttataaatgtcttgatgcttggtctcaaactgttaatgatttgatt
catgatttcgtacattataaatga

DBGET integrated database retrieval system