KEGG   Entamoeba histolytica: EHI_007330Help
Entry
EHI_007330        CDS       T00238                                 

Gene name
231.t00004
Definition
beta-N-acetylhexosaminidase, beta subunit (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ehi  Entamoeba histolytica
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EHI_007330 (231.t00004)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    EHI_007330 (231.t00004)
   00603 Glycosphingolipid biosynthesis - globo series
    EHI_007330 (231.t00004)
   00604 Glycosphingolipid biosynthesis - ganglio series
    EHI_007330 (231.t00004)
   00511 Other glycan degradation
    EHI_007330 (231.t00004)
Enzymes [BR:ehi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     EHI_007330 (231.t00004)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 565 aa AA seqDB search
MIVLLLLISYCFAGNGVNVKNQLLLMPYPTTVNAQFGSNDCVEATSNIKMVLSNNCQNDP
NCLSFMTFNFNHTITYPLQRQRNLEDFRVSIFAPIDIEEMKGNVVYSANTVNIELTGNNI
EEIYPPLKIGIDESYSLDVTKEGIKISATTVYGARLGLETLIQMLRPYQGKYIIKHIPIM
IEDKPRLQWRGLMIDVARNSFSRSAFVKIINAMAAIKANVLHIHLSDAQTFMFESKEYPE
LSKKGAFFQNKVLTQSFIKQLVQYGAKRGVIVYPEIDTPAHTASWNAGYPGVVADIWDYI
VSSSMRYGENVLALNPANEKTFSIIDALMKEMGEVFGNDYVHFGGDEVWTGAWSKAKEYP
AILEWMNKKGINTLKELEAYFNKYAQEQIIKNGKTPVCWEEVYQKGSADKKTIIQVWNNV
NLLKEAATAGYKVILSAGYYLDMQMPLCSDYVADSCTNPNHMWVWTNRDMYRNDPIKELD
YATKQNVLGGEACSWDESVDEQNFFDRVFQRFSAVAERFWSSEDITDPESHEVRANYVRC
LGLRRNFLKGTGPLYHSYCQLPEDI
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgattgttcttttacttctaatttcatattgttttgctggtaatggtgttaatgtgaaa
aaccaattacttttaatgccatacccaacaacagttaatgctcaatttgggtcaaacgat
tgtgttgaagcaacatcaaatattaaaatggtattatcaaataattgtcaaaatgatcct
aattgtttatcatttatgacatttaattttaatcatacaattacttatccattacaaaga
caaagaaatcttgaagattttagagtttctatttttgccccaattgatatagaagaaatg
aaaggaaatgttgtatattcagcaaatacagttaatattgaattaacaggaaataacatt
gaagaaatttatccaccacttaaaatcggaattgatgaaagttattcattagatgttaca
aaagaaggaattaaaattagtgcaacaacagtttatggagcaagattaggattagaaaca
ttaattcaaatgttaagaccatatcaagggaaatatattattaaacatataccaattatg
atagaagataaaccaagattacaatggagaggattaatgattgatgttgctagaaattca
ttttctagaagtgcatttgtaaaaattattaatgcaatggcagcaattaaggcaaatgta
ttacacattcatttaagtgatgcacaaacatttatgtttgaatcaaaagaatatcctgaa
ttaagtaaaaaaggagcatttttccaaaataaagtattaacacaatcttttattaaacaa
ttagtacaatatggagctaaaagaggagttatagtatatccagaaattgatacaccagca
catacagcatcatggaatgcaggatatccaggagtagttgcagatatttgggattatatt
gttagtagttcaatgagatatggagaaaatgtattagcattaaatccagcaaatgaaaaa
acatttagtataattgatgcattaatgaaagaaatgggagaagtatttggaaatgattat
gttcattttggaggagatgaagtttggacaggagcatggtcaaaagcaaaagaatatcca
gcaatattagaatggatgaacaagaaaggaatcaatacattaaaagaattagaagcatac
tttaataaatatgcacaagaacaaattattaaaaatggtaaaacaccagtttgttgggaa
gaagtttatcaaaaaggaagtgcagataaaaagactattattcaagtatggaataatgtt
aatttactaaaagaagcagcaacagctggttataaagttattttgtcagcaggatattat
ttagatatgcaaatgccattatgtagtgattatgtagcagatagttgtactaatccaaat
catatgtgggtatggacaaatagagatatgtatagaaatgatccaattaaagagttagat
tatgctactaaacaaaatgtattaggaggagaagcatgttcatgggatgaaagtgttgat
gaacaaaatttctttgacagagttttccaacgattctctgctgttgcagaaagattctgg
agttcagaagatattacagatcctgaaagtcatgaagttcgtgcaaattacgtaagatgt
cttggtttaagaagaaacttcttaaaaggaactggtccactttatcattcatattgtcaa
cttcctgaagacatctaa

DBGET integrated database retrieval system