KEGG   Entamoeba histolytica: EHI_011220Help
Entry
EHI_011220        CDS       T00238                                 

Definition
protein kinase
Orthology
K08850  
aurora kinase, other [EC:2.7.11.1]
Organism
ehi  Entamoeba histolytica
Brite
Enzymes [BR:ehi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     EHI_011220
Protein kinases [BR:ehi01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   EHI_011220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 295 aa AA seqDB search
MAAPRRVEQLSVNSPLKKEIESKPKKDDEKKPTQLSLDMFDIGKPLGQGKFGNVYLVKYK
KDNYVCALKVIFKRQLQQYRREIQMKREIELQSQLNHPNILKLFGLFEDKDRWFLVLEYC
KKGELYGLLQQAGRFDERRAARYIKATTEALKYCQEMNCIYCDLKPENIMIDHNDQVKLA
DFGWSVQAKTKRNTYCGTLDYLCPEIVLEKYYDGSIGQWCLGVLTFELCTGEPPFQSNSR
EEVMKKVRNVKYSFPSYLTNDCKDFINKLIQYDPSKRMSFAECLVHPWIVKNTTN
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcctcgtagggttgaacaattatcagtaaattctcctcttaaaaaagaaatt
gaaagtaaaccaaaaaaagatgatgaaaaaaagccaacccaattgtcgttggatatgttt
gatattggaaaaccacttggtcaaggaaaatttggaaatgtttatcttgtaaaatacaaa
aaagataattatgtttgtgcattaaaagttatatttaaaagacagttacaacaataccgg
agggagattcaaatgaaaagagagattgagttacaatctcaacttaaccatcctaatatt
ctcaaattattcggactttttgaagataaagacaggtggttccttgttcttgaatattgt
aagaaaggtgaattatatgggttattacaacaagctggtcgttttgatgaaagaagagct
gctcgatacataaaagcaacaactgaagctttaaagtattgtcaagagatgaattgtatt
tattgtgatttaaaaccagaaaacatcatgatagatcacaatgatcaagtcaaattagct
gactttggatggtctgttcaagccaagacaaaaagaaatacttattgtggtacattagat
tatttatgtcctgaaattgtattagaaaaatattatgatggatcgattggtcaatggtgt
ttaggagttttaacatttgaactatgtactggtgaacctccatttcaatctaacagtcgt
gaagaggttatgaaaaaagtcagaaatgttaaatattcttttccaagctatctcacaaat
gattgcaaagattttattaacaaactaattcaatatgatccttctaaaagaatgagtttt
gctgagtgtttagttcatccatggatagtcaaaaacacaacaaattga

DBGET integrated database retrieval system