KEGG   Entamoeba histolytica: EHI_012010Help
Entry
EHI_012010        CDS       T00238                                 

Gene name
16.t00041
Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ehi  Entamoeba histolytica
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EHI_012010 (16.t00041)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    EHI_012010 (16.t00041)
   00603 Glycosphingolipid biosynthesis - globo series
    EHI_012010 (16.t00041)
   00604 Glycosphingolipid biosynthesis - ganglio series
    EHI_012010 (16.t00041)
   00511 Other glycan degradation
    EHI_012010 (16.t00041)
Enzymes [BR:ehi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     EHI_012010 (16.t00041)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 563 aa AA seqDB search
MFFLLFYCIFSTLAGNGVNVKDQLLLVPYPQNIQFNKGSTNGIEIDETLTMSLSTQCQNN
PNCLSFMKFNFNHTITFPLQQQKNLRDFRISLHKAIDIPHIIPLKPNFIKKVHIIFKSSD
EKIFYPSTIIGSDESYSLSISTSSIIIEAQTVYGARHALETLLQLIRPNGNTFVISQLPI
TITDSPRFKWRGLMVDLARNAISKLTLVKTINALASLKMNVLHLHLTDSQSFMFESSSFP
ELSKQGAFNQENVLNKPFIIQLLRYAALRGILIYPEIDIPGHTASWGLGYPGVTVDCWDY
LTSNKILYAENRVSLNPTNETSFHIVQAVLKELAETFGSQYIHIGGDEVDNNCWLNSKEY
PAIKEWMKKNNFDSITDVESYYNQIAQEEVIKQGAHPIVWEEVFKKGNAKKESTIIQVWS
DIRQLKLAVDAGYKAIYSAGLYLDRQVPLCNNFDSSSCGQRYMWVWTTRDFYKHDPTKDF
TDAELENVYGGEGCSWDESCDDENFFDRVFQRFSAIAERFWSNKNLIDDESHEVRANYLR
CLGKRRGFLKGTGPLYTSYCDAK
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtttttcttattattctattgtattttttctacattagctggaaatggagtgaatgta
aaagatcaacttttgctagtaccatatcctcaaaatattcaatttaataaaggaagtaca
aatggaattgaaattgatgaaactttaacaatgagtttatcgactcaatgtcaaaacaat
cccaattgtttaagttttatgaaatttaattttaatcacacaataacttttcctttacaa
caacaaaaaaatctaagagattttagaatttcattacataaagctattgatatccctcat
attattcctttaaaacctaacttcattaaaaaagttcatattattttcaaatcttcagat
gaaaaaatattttatccatcaacaattattggttcagatgaatcttattctctttctatt
tctacttcttctattattattgaagctcaaactgtttatggagcaagacatgcattagaa
acattacttcaattaattcgacctaatggaaatacatttgttatttcacaattaccaata
acaatcactgattctccaagatttaaatggagaggattaatggttgatcttgctagaaat
gctattagtaaattaactcttgtaaaaactattaatgcattagcctcattaaaaatgaat
gttcttcatcttcatttaactgactctcaatcatttatgtttgaatcatcttcattccca
gaattatctaaacaaggtgcatttaaccaagaaaatgtattaaataaaccgtttattatt
caattattacgttatgctgctttaagaggtatacttatttatcctgaaattgatattcca
ggacatactgcatcatggggtcttggttatccaggagtaactgttgattgttgggattat
ttaacatcaaataaaatcttatacgctgaaaatagagtatcattaaatccaactaatgaa
acatcttttcatattgtacaagcagtattaaaagaattggcagaaacatttggaagtcaa
tatatccatattggaggtgatgaagttgataacaactgttggttaaattcaaaagaatat
cctgctattaaagaatggatgaaaaagaataactttgattcaattactgatgtagaaagt
tattataatcaaattgctcaagaagaagttataaaacaaggtgctcatcctattgtttgg
gaagaagtatttaagaaaggaaatgctaaaaaggaatcaacaatcattcaagtatggagt
gatattagacaattaaaattagcagttgatgctggatataaagcaatttattcagctgga
ttatacttagatagacaagtacctttatgtaataactttgattcatcttcttgtggacaa
cgatatatgtgggtttggacaacaagagacttttataaacatgatccaaccaaagacttt
actgatgctgaattagaaaatgtttatggtggagaaggatgttcttgggatgaaagttgt
gatgatgaaaatttctttgatagagttttccagagattctcagctattgcagaaaggttt
tggagtaataagaatcttattgatgatgaaagtcatgaagttagagcaaattatcttcgt
tgtttaggaaagagaagaggatttttaaaaggaacaggacctttatatacttcttattgt
gatgcgaaataa

DBGET integrated database retrieval system