KEGG   Entamoeba histolytica: EHI_012290Help
Entry
EHI_012290        CDS       T00238                                 

Gene name
16.t00011
Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
ehi  Entamoeba histolytica
Brite
Enzymes [BR:ehi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     EHI_012290 (16.t00011)
Peptidases [BR:ehi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   EHI_012290 (16.t00011)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 880 aa AA seqDB search
MNWFNTNPFTDFYVAITHLKRENKFPTNYMNSIHDGKTKKYFAVPITFVKNIHDAAVAYS
SLNEQDKQEMEKLYKLPKIDTALGLSDENGYLKGEVKENIDYLLISKKNKKMIKTLYGFF
DEDIKFPKLPKVYIYKTQEHIIKESIPIHLTVVFHFIGLDHKENKSEYIGEIYKNITISK
AIEKLQKDFQIDVNFTNYKVKVMKNEEEEVEDLENIISSILIDSNELNKVHVQIIEKQPT
IPNINYPYESNVSSKYSGYYGIRNEEEPNGIKGVCGLHNLGNTCYMNSAIQCLIHTTPLV
QFFQKDDWKKDINLNNPLGTSGKLVEQWSQLLRKYWSGYSTISPKEFKFAIGEFAPQFSG
YQQHDSQELVAYLIDGIHEDLNRVLKKPYVETPDYNNEPDDEWAVAEWNRYKQRNDSIIT
DLFAAQLKSKVICDVCHNTNMRFDPYVFLSLAIPNKQNSVSIYVCDKNYQNTKTIKINIK
GKNIEEIIEESTKDICLNTNPNNFVIVQFGYEKKVEKIITNGKLEKDMEYGIIEKQDNES
DFIVYDCLIKYASYRQYRIPIVFGKSINKEIVDEKIFELFKDTYKNNVNAWDSKTILSNK
KIHEDEEDEEDNMNNNIKENQNNGTLIFNNKQLEKEQEEQLEKEQEIEEKKWYFEFNEEH
ENIIQCQSIDSGTFKYLYDRGLSYRYNQIDGDPVTLEECFEAFEVEELMDENNKVYCSKC
KEHQPSHKKVDLWSTNQILIIHLKRFGNSNGYSRDKITTFVDFPIESLDLTRFVKHYDPT
TPPIYNLYGVTNHMGSLGGGHYVASARVGNDWYDFNDSTTSKIEGTKENIVSKNAYVLYY
IRKDIDQQTNINTEEFTKEEGNEVQEELTPENDNGLMKEI
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgaattggttcaatacaaatcctttcacagacttctatgttgcaattactcatcttaaa
agggagaacaaatttccaacaaattatatgaatagtatccatgatggtaaaacaaaaaag
tattttgctgtaccaataacatttgtaaagaatattcatgatgcagcagttgcttatagt
tcattaaatgaacaagataaacaagaaatggaaaaattatataaattacctaaaatagat
acagcattaggattaagtgatgaaaatggatatctcaaaggagaagtaaaagagaacata
gattatttattaattagtaaaaagaataagaaaatgataaaaacactctatggatttttt
gatgaagatatcaaatttcctaaattacctaaagtttatatttataaaacacaagaacat
attattaaagaaagtattccaatacatttaactgttgtttttcattttattggacttgat
cataaagaaaataaaagtgaatatataggagaaatatataaaaatattactatttcaaaa
gcaattgagaaattacaaaaagactttcaaattgatgttaactttacaaattataaagtt
aaagtaatgaaaaatgaagaagaagaagtagaagatttagaaaatattatatcatcaatt
cttattgattcaaatgaattaaataaagttcatgttcaaattattgaaaaacaaccaaca
ataccaaatataaattatccatatgaatcaaatgttagttcaaaatattctggatattat
ggaattagaaatgaagaagaaccaaatggaataaaaggtgtttgtggattacataattta
ggaaatacatgttatatgaattctgctattcaatgtttaattcatacaactccattagtt
caattctttcaaaaagatgattggaaaaaagatattaatttaaataatccattaggaaca
tcaggtaaattagttgaacaatggagtcaattattaagaaaatattggtcaggatattct
actatttctcctaaagaatttaaatttgctattggagaatttgcaccacaatttagtgga
tatcaacaacatgattcacaagaattagtagcatatttaattgatggaatacatgaagat
ttaaatcgtgttttaaagaaaccatatgttgaaacaccagattataataatgaaccagat
gatgaatgggctgtggctgaatggaatagatataaacaaagaaatgattcaattattaca
gacttatttgcagcacaacttaaaagtaaagttatttgtgatgtttgtcataataccaat
atgagatttgatccatatgtattcttatcacttgcaattccaaataaacaaaactcagta
tcaatttatgtttgtgataagaattatcaaaatactaaaacaattaaaataaatattaaa
ggaaaaaacattgaagaaattattgaagaatcaacaaaagatatttgtttaaatacaaat
ccaaataattttgttattgtacaatttggatatgaaaaaaaggttgaaaaaataataaca
aatggtaaattagaaaaagacatggaatatggtattattgaaaaacaagacaatgaatct
gattttattgtttatgattgtttaataaaatatgcttcatatagacaatatagaatacca
attgtgtttggtaaatcaattaataaagaaattgttgatgaaaaaatatttgaattattt
aaagatacttataaaaacaacgtaaatgcttgggactcaaaaactattctttctaataaa
aaaattcatgaagatgaagaagatgaagaagataatatgaataataatattaaagaaaat
caaaataatggtactttaatttttaataataaacaattagaaaaagaacaagaagaacaa
ttagaaaaagaacaagaaattgaagaaaaaaaatggtattttgaatttaacgaagaacat
gaaaatattattcaatgtcaaagtattgatagtggaacatttaaatatttatatgacaga
ggattgtcatatcgttataatcaaattgatggtgatcctgttactcttgaagaatgtttt
gaagcatttgaagtagaagaattaatggatgaaaataataaagtgtattgttctaaatgt
aaagaacaccaaccatcacataaaaaagttgatctttggagtactaatcaaatacttatt
attcatttaaaaagatttggtaatagcaatggatattctcgtgataaaattactacattt
gttgatttcccaattgagtcattagatcttactcgttttgttaaacactatgacccaaca
acacctccaatttataatttatatggtgttactaatcatatgggttctcttggtggtgga
cattatgttgcatctgctcgtgttggaaatgattggtatgattttaatgactcaaccact
tcaaagattgaaggaacaaaagaaaatattgtttcaaagaatgcttatgtgttgtattac
attagaaaagatattgaccaacaaacaaatatcaatacagaagaatttaccaaagaagaa
ggaaatgaagttcaagaagaattaacaccagaaaatgataatggcttaatgaaagaaatt
taa

DBGET integrated database retrieval system