KEGG   Entamoeba histolytica: EHI_020250Help
Entry
EHI_020250        CDS       T00238                                 

Gene name
334.t00005
Definition
lecithin:cholesterol acyltransferase domain-containing protein
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
ehi  Entamoeba histolytica
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    EHI_020250 (334.t00005)
Enzymes [BR:ehi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     EHI_020250 (334.t00005)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 399 aa AA seqDB search
MNIFFLCLTLSIAIAETCTRHPVIIIPGIMASMLNAKINIPKNVDFCDRKLDCDRSKDWF
TLWLNLLDGIPYVNDCYIAYLTCHYNSTSGRMENVEGVQIEPPRFGSTYAVDTISPSFPL
KTFSRAFHEVIKGLQKIGYKDEFDLFSAPYDWRYYHHDEYYEKVKELIIKAYENTGNKVV
LVSHSMGGLTTYILLDKLGKEFCDKYIHRWVAMSTPFIGTTIANDVVLAGYNMGYPVSKE
LIKKAARTFETVAMMGPIGEYWDQNEVLVELANGKKYYPKDQIELFSQLEEMKPFAKEAV
ENSFAPYLKKYNSQVPHGVEMHCGITSGIETAHKITFKGDTFDSKSTIEFVDGDQEVTLN
SLEYCKKMTENFTNLGKYTHQGMLLKKEVIEYVKNLACD
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacattttctttctttgtttgactttatctattgctattgcagaaacctgtacccgt
catccagttattattattcctggaattatggcttcaatgcttaatgctaaaataaatatc
cctaagaatgttgacttctgtgatagaaaacttgattgcgatagatctaaagattggttc
acattatggctaaatctgttagatggaattccatatgtcaatgattgttatattgcttat
ttaacatgtcattataattcaacttcaggtagaatggaaaatgttgaaggagtacaaata
gaacctccaagatttggatctacttatgccgtagatactatctctccatcattcccatta
aagacattttctcgtgcattccatgaagttataaaaggattacaaaaaattggatataaa
gatgaatttgatttgttctctgcaccttatgattggaggtattatcatcatgatgaatat
tatgaaaaagttaaagagttaataattaaagcttatgaaaatactggtaataaagtagtt
ttagtttcacattctatgggaggattaactacttatattttattagataaacttggcaaa
gagttttgtgataagtatattcatagatgggttgctatgtctactccattcattgggaca
actattgctaatgatgttgttcttgctggatataatatgggatatcctgtttctaaagaa
ttaattaaaaaagcagcaagaacatttgagacagtagctatgatggggcctataggagag
tattgggatcaaaatgaagttttagtagaattagctaatggcaagaaatattatccaaaa
gaccaaattgagttatttagtcaattagaagaaatgaaaccatttgctaaagaagcagta
gaaaattcatttgctccatatcttaagaaatataattcacaagtaccacatggagtagaa
atgcattgtggtattacaagtggaatagaaactgcacataaaataacatttaaaggggat
acttttgattctaaatcaactatagaatttgtagatggtgatcaagaagttactttgaac
agtttagaatattgtaaaaagatgacagaaaactttactaatttaggtaaatatactcac
caaggaatgttgttaaagaaagaagtgattgaatatgttaaaaatcttgcttgtgactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system