KEGG   Entamoeba histolytica: EHI_021560Help
Entry
EHI_021560        CDS       T00238                                 

Gene name
253.t00005
Definition
thioredoxin
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ehi  Entamoeba histolytica
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    EHI_021560 (253.t00005)
Enzymes [BR:ehi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     EHI_021560 (253.t00005)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 379 aa AA seqDB search
MFSLFLTLLVLTNAHFFGDAPIYMPQNMQEIKALESSSSATILMLYAPWCGHCKHLAPEF
ASAAKEVNGKTIFAAVDCEEHRDICGNYGVQGFPTVKLFDAQQGHQRRTPRDYNGPREAR
AISGTMYSMIPDWVETIPTELNKDENSVILFSDKPKRTLLYKALAMHLNGAFKFYDCNKD
NEQVKKYGVEQFPTILIQHKGEIKKYEGKMDLNSMLAYLSNLAGINTSSGNEQPERPKEE
EVPYVNVHVLNDEMFKKQCNGKACLLLIFGEEENNELINQVSKGLEGKMHTLSFTCSEQN
DLCNKLNVFFDTPTALIYIPQRGRLIRFVGGFDAEEVISFAKNSLIGRVGKIETLKDFPS
FKDRVKEPYVAPKYEEEEL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgttttctttattcttaactcttcttgttcttactaatgcacacttttttggagatgca
ccaatttatatgcctcaaaacatgcaagaaattaaagcattagaaagttcttcttcagca
acaattttaatgttatatgccccatggtgtggtcattgtaaacaccttgcaccagaattt
gcttctgctgctaaggaagtcaatggaaaaacaatttttgctgctgttgattgtgaagaa
catagagatatttgtggaaattatggggttcaaggttttccaacagttaaattatttgat
gctcaacaaggacaccaacgcagaacaccacgagattataatggtccaagagaagctagg
gctattagtggtacaatgtattcaatgattcctgattgggttgaaactattccaacagaa
ttaaataaagacgaaaacagtgttattttgtttagtgacaaaccaaaaagaacattatta
tataaagcacttgctatgcatcttaatggagcttttaaattttatgattgtaataaagac
aatgaacaagtaaaaaaatatggagttgaacaattcccaacaatacttattcaacataaa
ggagaaattaaaaaatatgaaggtaaaatggatttaaatagtatgttagcttatttaagt
aatttagctggtattaatacaagttcaggaaatgaacaaccagagagaccaaaagaagaa
gaagttccttatgttaatgttcatgttttaaatgatgaaatgtttaagaaacaatgtaat
ggaaaggcatgtcttttattaatctttggagaagaagaaaataatgaattaattaaccaa
gttagtaaaggacttgaaggtaaaatgcatacattatcattcacttgttctgaacaaaat
gatctctgtaataaattaaatgttttctttgatacaccaactgctcttatttatatccca
caacgaggaagattaattcgatttgttggaggatttgatgccgaagaagtaatttcattt
gctaaaaacagtttgattggaagggtaggaaaaattgaaacattaaaagattttccttct
tttaaagacagagtaaaagaaccatatgttgctccaaaatatgaagaagaagaactttaa

DBGET integrated database retrieval system