KEGG   Entamoeba histolytica: EHI_023410Help
Entry
EHI_023410        CDS       T00238                                 

Gene name
25.t00015
Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
ehi  Entamoeba histolytica
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    EHI_023410 (25.t00015)
Enzymes [BR:ehi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     EHI_023410 (25.t00015)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 426 aa AA seqDB search
MSGIEEYVEVGNEKIAKKDICLYKYEDGKFIGHLLEAKGKTKKHRVIKVKMEKEEYEKLK
TEIDKKKKYPKLYIILNPFSGTKKGETIMKEIEEYLKSMGIIYTIQKTEYAGHEQEIAEK
TDFSQYDVIVSGGGDGTLHSIINGVISQHKKEIPIISPLACGSGNGVAYSLYKDNEPITG
MCHIVCGEVTRIDGIILNHNKEKKKYYGVLQFEFSYLSSIDFESECIRWLGAFRFILWTL
WYCVTLMTTKAKIKTKKYEMTNDGECGALCSTCKNNKIKEIDYTKDIADQIIQQHVNPDS
SLSKNDGWEELPYSSYCIYFFNNFAYGMPGIEFAHGAHRNDGFIDSWVLPGERATRWRFL
GFWICAVLNLFVPNYISGFDYFRSTALSIRLQNDVIIGIDGEKLPPGNSFDLYVAPGLYR
TMLCTN
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggatagaggaatatgttgaagtaggaaatgagaaaattgcaaaaaaggatatt
tgtctttacaaatatgaagatgggaaattcataggacatcttcttgaagccaaaggtaaa
actaaaaagcatcgagttattaaagtgaaaatggaaaaagaagaatatgaaaaattgaaa
acagagatagataaaaagaaaaaatatccaaaattatatattatattaaatccatttagt
ggaacaaaaaaaggagaaacaataatgaaagaaatagaagaatatttaaaaagtatggga
ataatatatacaattcaaaaaacagaatatgcaggacatgaacaagaaatagcagaaaaa
acagattttagtcaatatgatgttattgtatcaggaggaggagatggaacattacattct
ataattaatggagttatttcacaacataaaaaagaaattccaataatatcaccacttgca
tgtggatcaggaaatggagtagcatatagtttatataaagacaatgaaccaataacagga
atgtgtcatatagtatgtggagaagttacaaggattgatggaattatattaaatcataat
aaagaaaaaaagaaatattatggagtattacaatttgaattttcatatttatcaagtatt
gattttgaaagtgaatgtattagatggcttggagcatttagatttatattatggacactt
tggtattgtgttacactcatgactactaaagcaaaaataaagactaaaaagtatgaaatg
acaaatgatggagaatgtggagcattatgttctacttgtaaaaataataaaataaaagaa
atagattataccaaagacattgctgatcaaattattcaacaacacgtaaatccagattct
tctctctctaaaaatgatggttgggaagaattaccttattcttcttattgtatttacttt
tttaataatttcgcttatggaatgccaggaattgaatttgctcatggtgcacatagaaat
gatggttttattgattcatgggttcttcctggtgaaagagcaactcgttggagattttta
ggtttttggatttgtgctgtactcaatctttttgtacctaattatatttctggttttgac
tattttagatcaaccgctttatctattagactacaaaatgatgttataattggtattgat
ggtgaaaaacttcctccaggaaatagctttgatttatatgttgctcctggtttatatcgt
actatgttatgcactaactaa

DBGET integrated database retrieval system