KEGG   Entamoeba histolytica: EHI_040260Help
Entry
EHI_040260        CDS       T00238                                 

Gene name
144.t00022
Definition
HEAT repeat domain containing protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
ehi  Entamoeba histolytica
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1074 aa AA seqDB search
MTKDEESKTVYEGICYSTPLPTRSFFYDESIGINTKRIKTIHLILTLCLNIGTDSPDQIK
QKDSASKECWIDTAGKTNRKLVYDIAANLTDQYRSWQNGSKIEPCCDPTYEDVRRLCLTF
RRMADTDRILFHYNGHGVPLPTLNGEIWFFDKEFTQYIPLQIYELLQTIGTPSIYIFDCS
CAGRIITWCKKYAQSKQKKNKNKNGENYMFLGSCQDDEMLPTNPFYPADLFTSCLTTPLR
VAVLYYIQNSLLMKWDATIIDRIPGVLNNRRTPLGELNWIFTAITDSIAWNVLPRPLFYK
LFRQDLLIASLYRNFFLAQRVMQSLKCKPISYPILPDASNHYLWVVWDRALELCLLQINN
HCNSFNESTSSFFDEQLVAFEVWLESDNIANCIAAQLPILLQVLLSQTLRERALKLLCRF
LDLGPWACDQALAVGIFPYILKLLSSTTSVDFYEYLVFCWMKILVVDKKKTFHQNLIREN
HQIYFLNVLKNNTKNLNTGTNAYALFILTTLLEDNTQVKATLVQANIIEVIHFYFKSENI
EVRSWALLCLSKLWEGSVEIKIRAQKKGIINSLMLLLQDPNPRVRVALLNCLTTLIGEPY
ADIGEACNEIALKTAVLVHDACPKVREHLIVLYQRLAKVLVGTVKESKIFEQTVEIGKED
PDTDVNGAAEILNEILEIYTNKEEGRTITPQRRISALNTIVNKLYESRVYELSQPLLKKR
KEITPQRKWFKEKYVESRTQFTLIGSDFENHKLKQIGRFIGEEGHEFNPGNMLFHPTLPL
LVVGSNKGSTIRVFDTNSESVVNAWNNLNSGNKSVSGMTWINKTDIPMLVTSTNDGAIRI
WRNWEDSGSNVLVSSFKGVMEECLPDIGAKVVGLGESRLLTAGNSMIRIWDLEKEELEAN
IRMKTSITCVNEYNEFSDHMFLVGNVNGKVTLYDMRLSPQEREVKTWKISHSPIITTSRP
SSGNTIIAGAVARLNEPSLAGLIDIRASQIRKLYVPKLTTLVTHPTATYFVCGSAEQFIR
SYNSESGKMIQEIKYYDGFFGHRINPVVNMAITQFGFNMAVSSTDSSITLFGFD
NT seq 3225 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagatgaagaaagtaaaactgtgtatgaagggatatgttatagtacaccactt
ccaacaagatcatttttttatgatgagagtataggaataaacaccaaacgaataaagacg
attcatttaatacttacgttatgtttaaatatagggactgattcacctgaccaaattaaa
caaaaagattcagcatcaaaagagtgttggatagatacagcagggaaaacaaaccgaaaa
ttagtgtatgatatagcagcgaatcttacagatcaatatcggtcatggcaaaatggaagt
aaaattgaaccatgttgtgatccaacatatgaagatgtcagaagattatgtttaacattt
agacgaatggcagatacggatagaattttatttcattataatggacatggagtaccatta
ccaacattaaatggggagatatggttttttgataaagaatttacacaatatattccactt
caaatctatgaattattacaaacgataggaacaccaagtatatacatatttgattgtagt
tgtgcaggaagaattattacgtggtgtaaaaaatatgcacaaagtaagcaaaagaaaaat
aaaaacaaaaatggggaaaattatatgtttcttgggtcatgtcaagatgatgaaatgtta
ccaacaaatccattttatccagctgatttatttacatcatgtttaacaaccccattaaga
gttgcagtattatattatattcaaaattcgttattaatgaaatgggatgcaacaataata
gatagaattccaggggtattaaataatagaagaacaccactaggagaattaaattggata
ttcacagcaataacagactccatagcatggaatgtattaccacgaccattattttataaa
ttatttcgacaagatttattaatagcatcattatatagaaatttcttcttagcacaaaga
gtaatgcaatcactcaagtgtaaacctatatcatatccaattttaccagatgcatcgaat
cattatttatgggtagtttgggatagagcacttgaattatgtttattacaaattaataat
cattgtaatagttttaatgaaagtacatcatcattttttgatgaacaattagttgcattt
gaagtatggttagaatcagataatattgctaattgtattgcagcacaacttccaattttg
ttacaagtattattatcacaaacattaagagaaagagcattaaagttattatgtcgattt
ttagatttaggaccatgggcatgtgaccaagcattagcagtaggaatctttccatatata
ttaaaattattaagttccacaacaagtgtagatttttatgaatatttagtgttttgttgg
atgaaaatacttgttgttgataaaaagaaaacattccatcaaaaccttattagagaaaat
catcaaatctactttttaaatgtgttaaaaaataatacaaaaaatttaaatacaggaaca
aatgcatatgcattatttattttaactacattattagaagacaatacacaagttaaagca
acattagttcaagcaaatattatagaagttattcatttttattttaaaagtgaaaatatt
gaagtaagatcatgggcattattatgtttaagtaaattatgggaaggaagtgttgaaatt
aaaataagggcacaaaagaaaggaattattaattcattaatgttacttttacaagaccca
aatccaagagtaagagtggcattattaaattgcttaactacattaattggagagccatat
gctgacattggagaagcatgtaatgagattgcattaaaaacagcagttttagttcatgat
gcatgtcctaaagtaagagaacatttaattgttttataccaaagattagcaaaagtgtta
gttgggacagttaaagagtctaagatatttgaacaaacggttgaaattggaaaggaagat
cctgatacggatgtcaatggagcagcggaaatcttaaatgaaatactagaaatatataca
aataaagaagaaggaagaacaataaccccacaaagaagaattagtgcattaaatacgatt
gtaaataagttatatgaatcaagagtatatgaattatcacagccattattaaaaaagaga
aaagaaattacaccacaaagaaaatggtttaaagaaaagtatgttgaaagtcgaacacaa
tttacacttataggaagtgactttgaaaatcataaattaaaacaaatagggaggtttatt
ggagaagaaggacatgaatttaatccggggaatatgttatttcatccaacattaccatta
ttagttgtaggaagtaataaagggtcaacaataagagtatttgatactaacagcgaaagt
gttgtcaatgcatggaataatttaaattcaggaaataaaagtgtaagtggaatgacatgg
ataaataaaacagatattccaatgttagttacatcaactaatgatggagcaataagaatc
tggagaaattgggaagatagtggaagtaatgtacttgtaagtagttttaaaggtgttatg
gaagaatgtttaccagatattggagcaaaagtagttggattaggtgagagtcgattatta
actgcaggaaattctatgataagaatatgggatttagaaaaagaagaattagaagcaaac
attagaatgaaaacatcaattacatgtgttaatgaatataatgaatttagtgatcatatg
tttcttgtaggaaatgttaatggaaaagtgacattatatgatatgagattatctccacaa
gaaagagaagtaaaaacatggaaaatttcacattcaccaattattactacatcaagacca
agttcaggaaatacaattattgcaggagctgttgctagacttaatgaaccatcattagct
gggttaattgacattcgtgctagtcaaataagaaaactttatgtcccaaaacttactaca
ttagtaacacatcccactgctacatattttgtttgtggaagtgctgaacaatttattagg
tcatataatagtgaatcaggtaaaatgattcaagaaattaaatattatgatggtttcttt
ggtcatagaattaatccagtagttaatatggctatcactcaatttggattcaatatggct
gtttcttctactgattcaagtattactttatttggttttgattaa

DBGET integrated database retrieval system