KEGG   Entamoeba histolytica: EHI_040260Help
Entry
EHI_040260        CDS       T00238                                 

Gene name
144.t00022
Definition
(RefSeq) HEAT repeat domain containing protein
  KO
K07204  
regulatory associated protein of mTOR
Organism
ehi  Entamoeba histolytica
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1074 aa AA seqDB search
MTKDEESKTVYEGICYSTPLPTRSFFYDESIGINTKRIKTIHLILTLCLNIGTDSPDQIK
QKDSASKECWIDTAGKTNRKLVYDIAANLTDQYRSWQNGSKIEPCCDPTYEDVRRLCLTF
RRMADTDRILFHYNGHGVPLPTLNGEIWFFDKEFTQYIPLQIYELLQTIGTPSIYIFDCS
CAGRIITWCKKYAQSKQKKNKNKNGENYMFLGSCQDDEMLPTNPFYPADLFTSCLTTPLR
VAVLYYIQNSLLMKWDATIIDRIPGVLNNRRTPLGELNWIFTAITDSIAWNVLPRPLFYK
LFRQDLLIASLYRNFFLAQRVMQSLKCKPISYPILPDASNHYLWVVWDRALELCLLQINN
HCNSFNESTSSFFDEQLVAFEVWLESDNIANCIAAQLPILLQVLLSQTLRERALKLLCRF
LDLGPWACDQALAVGIFPYILKLLSSTTSVDFYEYLVFCWMKILVVDKKKTFHQNLIREN
HQIYFLNVLKNNTKNLNTGTNAYALFILTTLLEDNTQVKATLVQANIIEVIHFYFKSENI
EVRSWALLCLSKLWEGSVEIKIRAQKKGIINSLMLLLQDPNPRVRVALLNCLTTLIGEPY
ADIGEACNEIALKTAVLVHDACPKVREHLIVLYQRLAKVLVGTVKESKIFEQTVEIGKED
PDTDVNGAAEILNEILEIYTNKEEGRTITPQRRISALNTIVNKLYESRVYELSQPLLKKR
KEITPQRKWFKEKYVESRTQFTLIGSDFENHKLKQIGRFIGEEGHEFNPGNMLFHPTLPL
LVVGSNKGSTIRVFDTNSESVVNAWNNLNSGNKSVSGMTWINKTDIPMLVTSTNDGAIRI
WRNWEDSGSNVLVSSFKGVMEECLPDIGAKVVGLGESRLLTAGNSMIRIWDLEKEELEAN
IRMKTSITCVNEYNEFSDHMFLVGNVNGKVTLYDMRLSPQEREVKTWKISHSPIITTSRP
SSGNTIIAGAVARLNEPSLAGLIDIRASQIRKLYVPKLTTLVTHPTATYFVCGSAEQFIR
SYNSESGKMIQEIKYYDGFFGHRINPVVNMAITQFGFNMAVSSTDSSITLFGFD
NT seq 3225 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagatgaagaaagtaaaactgtgtatgaagggatatgttatagtacaccactt
ccaacaagatcatttttttatgatgagagtataggaataaacaccaaacgaataaagacg
attcatttaatacttacgttatgtttaaatatagggactgattcacctgaccaaattaaa
caaaaagattcagcatcaaaagagtgttggatagatacagcagggaaaacaaaccgaaaa
ttagtgtatgatatagcagcgaatcttacagatcaatatcggtcatggcaaaatggaagt
aaaattgaaccatgttgtgatccaacatatgaagatgtcagaagattatgtttaacattt
agacgaatggcagatacggatagaattttatttcattataatggacatggagtaccatta
ccaacattaaatggggagatatggttttttgataaagaatttacacaatatattccactt
caaatctatgaattattacaaacgataggaacaccaagtatatacatatttgattgtagt
tgtgcaggaagaattattacgtggtgtaaaaaatatgcacaaagtaagcaaaagaaaaat
aaaaacaaaaatggggaaaattatatgtttcttgggtcatgtcaagatgatgaaatgtta
ccaacaaatccattttatccagctgatttatttacatcatgtttaacaaccccattaaga
gttgcagtattatattatattcaaaattcgttattaatgaaatgggatgcaacaataata
gatagaattccaggggtattaaataatagaagaacaccactaggagaattaaattggata
ttcacagcaataacagactccatagcatggaatgtattaccacgaccattattttataaa
ttatttcgacaagatttattaatagcatcattatatagaaatttcttcttagcacaaaga
gtaatgcaatcactcaagtgtaaacctatatcatatccaattttaccagatgcatcgaat
cattatttatgggtagtttgggatagagcacttgaattatgtttattacaaattaataat
cattgtaatagttttaatgaaagtacatcatcattttttgatgaacaattagttgcattt
gaagtatggttagaatcagataatattgctaattgtattgcagcacaacttccaattttg
ttacaagtattattatcacaaacattaagagaaagagcattaaagttattatgtcgattt
ttagatttaggaccatgggcatgtgaccaagcattagcagtaggaatctttccatatata
ttaaaattattaagttccacaacaagtgtagatttttatgaatatttagtgttttgttgg
atgaaaatacttgttgttgataaaaagaaaacattccatcaaaaccttattagagaaaat
catcaaatctactttttaaatgtgttaaaaaataatacaaaaaatttaaatacaggaaca
aatgcatatgcattatttattttaactacattattagaagacaatacacaagttaaagca
acattagttcaagcaaatattatagaagttattcatttttattttaaaagtgaaaatatt
gaagtaagatcatgggcattattatgtttaagtaaattatgggaaggaagtgttgaaatt
aaaataagggcacaaaagaaaggaattattaattcattaatgttacttttacaagaccca
aatccaagagtaagagtggcattattaaattgcttaactacattaattggagagccatat
gctgacattggagaagcatgtaatgagattgcattaaaaacagcagttttagttcatgat
gcatgtcctaaagtaagagaacatttaattgttttataccaaagattagcaaaagtgtta
gttgggacagttaaagagtctaagatatttgaacaaacggttgaaattggaaaggaagat
cctgatacggatgtcaatggagcagcggaaatcttaaatgaaatactagaaatatataca
aataaagaagaaggaagaacaataaccccacaaagaagaattagtgcattaaatacgatt
gtaaataagttatatgaatcaagagtatatgaattatcacagccattattaaaaaagaga
aaagaaattacaccacaaagaaaatggtttaaagaaaagtatgttgaaagtcgaacacaa
tttacacttataggaagtgactttgaaaatcataaattaaaacaaatagggaggtttatt
ggagaagaaggacatgaatttaatccggggaatatgttatttcatccaacattaccatta
ttagttgtaggaagtaataaagggtcaacaataagagtatttgatactaacagcgaaagt
gttgtcaatgcatggaataatttaaattcaggaaataaaagtgtaagtggaatgacatgg
ataaataaaacagatattccaatgttagttacatcaactaatgatggagcaataagaatc
tggagaaattgggaagatagtggaagtaatgtacttgtaagtagttttaaaggtgttatg
gaagaatgtttaccagatattggagcaaaagtagttggattaggtgagagtcgattatta
actgcaggaaattctatgataagaatatgggatttagaaaaagaagaattagaagcaaac
attagaatgaaaacatcaattacatgtgttaatgaatataatgaatttagtgatcatatg
tttcttgtaggaaatgttaatggaaaagtgacattatatgatatgagattatctccacaa
gaaagagaagtaaaaacatggaaaatttcacattcaccaattattactacatcaagacca
agttcaggaaatacaattattgcaggagctgttgctagacttaatgaaccatcattagct
gggttaattgacattcgtgctagtcaaataagaaaactttatgtcccaaaacttactaca
ttagtaacacatcccactgctacatattttgtttgtggaagtgctgaacaatttattagg
tcatataatagtgaatcaggtaaaatgattcaagaaattaaatattatgatggtttcttt
ggtcatagaattaatccagtagttaatatggctatcactcaatttggattcaatatggct
gtttcttctactgattcaagtattactttatttggttttgattaa

DBGET integrated database retrieval system