KEGG   Entamoeba histolytica: EHI_044890Help
Entry
EHI_044890        CDS       T00238                                 

Gene name
3.t00009
Definition
helicase
Orthology
K01509  
adenosinetriphosphatase [EC:3.6.1.3]
Organism
ehi  Entamoeba histolytica
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    EHI_044890 (3.t00009)
Enzymes [BR:ehi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     EHI_044890 (3.t00009)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 955 aa AA seqDB search
MSRTETPSLEDSIDIIKLLRNKKIKELNKGIQFKELDNDKKIEHIKELILIATEDPSIEK
RKNNKKGARRSIQDEEDTDIESVVQSISTAMYFENSPPYIKNGQLKPFQIDALNWLIRRH
HLGVNSILADEMGLGKTLESISLLGYLYHVQDCHGPHIVISPKSTIDNWKNEINKWLPSI
KVALMGGTRESREDCRKENFDKDKLKADVIICSYQVISKEKSLLKKQKFVYLILDEAHSA
KNENTRFYNDLSEINASHKLFLTGTPLQNTLHELWSLLQFLLPEIFNTKELDEIFESIES
DKFQGYIDSIRDFIKPFMLRRLKTDVQKELPPKMEIKIFVQLTPFQKIWYRKVLMGDVTV
IIGDKIVKSKLNNTMTQLRKVCDHPYLMPGAEPEPYVNGEHLCLSSAKMIVMEKLVEKHL
KNNGKILIFSQMTRMLDIIDDYLVFKDIEHYRIDGQTQQEDRVEQIKDFNDPNGKVSIFL
LSTRSGGLGINLQSADTVILYDSDWNPQSDIQAMDRAHRIGQTKPVTVYRLICEGTAEQR
LIRVAERKLMLNRLVMQSGKTATEPAIGKEELLQIMQQELTGCLKEESDDKKVKEKNKDL
KDIDIESIIQSGKEKTQELKNEIEKETETAKKGMMNLTNFAFGVEKVDIREFEGKVFGQN
DNLEDLERYKENMKLVRTETLKQPPAIKFRDLQFPSKELLQLLDKENEEYKRLNATFKED
LTFAILKGDSLDPILHPKYLSDEDNQRKEKLLKETFYDWDDNDFRKWKTAMKKYGYEKLD
EISTYMGKDKQEVQRYNNVFIQRYNEVNEGEKLYNSLFKSEQKRKLREKEQEDLAQAIKA
KPDDMTVLTPYVYFGNSQTDPLVDSMMLRKYAEYGEDWERILKEIKEHPLFVFNIYINSY
TPQTVKEKIRFLIHNVEKTKEKMTKENDGNIVLDKIEINDNFENKKMRKEDDNND
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaactgaaaccccgagtcttgaagattctattgatataattaaactgttgcgt
aataaaaaaataaaagaactaaacaaaggaattcaatttaaagaattagataatgataag
aagattgaacacattaaagaattaattcttatagcaacagaagatccatctatagaaaaa
agaaaaaataataaaaaaggagcacgaagaagtattcaagatgaggaagatacagatata
gagtcagtggttcaatcaatttcaacagcaatgtattttgaaaatagtccaccttatatt
aaaaatggacagttgaaaccatttcaaattgatgccttaaattggttaatcagaagacat
catcttggggtaaattcaattcttgctgatgagatggggttaggaaagacattagaaagt
attagtttattaggatatttatatcatgtacaagactgtcatggaccacatattgttata
tctccaaaatctacaattgacaattggaaaaatgaaattaataaatggttgccatcaata
aaagttgctctaatgggaggtacaagagaatcaagagaggattgtagaaaagagaatttt
gataaagataaactaaaggctgatgtgattatttgtagttatcaagttatttcaaaagag
aaatcactattaaagaaacaaaaatttgtatatttaatattagatgaagctcatagtgca
aaaaatgaaaatacacgtttctataatgacttaagtgaaattaatgcatcacataaacta
tttcttacaggaacaccattacagaatacattacatgaattatggtcattattacaattt
ttattacctgaaatatttaatacaaaagaattagatgaaatatttgaatcaattgagtca
gataaatttcaaggatatattgattctattagagattttattaaaccatttatgttgaga
aggttaaaaacagatgttcaaaaagaattaccaccaaaaatggaaattaaaatctttgta
caacttacaccatttcaaaaaatttggtacagaaaagtattaatgggtgatgtaactgtt
attattggagacaaaattgttaaatcaaaattgaataacactatgactcaactaagaaaa
gtttgtgaccatccatatcttatgcctggagcagagccagagccatatgtcaatggagaa
cacttatgtctatcttctgctaagatgattgtaatggaaaagttagttgaaaaacattta
aaaaataatggaaaaatattaatattttcacaaatgacaaggatgttagatattattgat
gattatcttgtgtttaaagatattgagcattatagaattgatggacaaacacaacaagaa
gatcgtgttgaacaaattaaagattttaatgacccaaatggtaaggttagtatttttctg
ttatcaacacgaagtggtgggttaggtattaatttacaaagtgctgataccgttatatta
tatgactctgattggaatccacaatctgatattcaggcaatggacagagctcatagaatt
ggtcaaactaaaccagttactgtttatcgtttaatttgtgaaggaactgctgaacaacga
ttgattagagttgcagaaagaaaattaatgttaaatagacttgtaatgcaaagtggaaaa
acagcaacagaaccagcaattgggaaagaagaattgttacaaattatgcaacaagaatta
actgggtgtttaaaagaagaaagtgatgataagaaagtaaaagaaaaaaataaagattta
aaggatattgatattgaatcaattattcaaagtggaaaagaaaagacacaagaactaaag
aatgaaattgaaaaagaaacagagacagcaaaaaaaggaatgatgaatttaactaatttt
gcatttggagttgaaaaagttgatataagagaatttgaaggaaaagtgtttgggcaaaat
gataatttagaagatttagaacgttataaagaaaatatgaaattggttcgtactgaaaca
ttaaaacaacctcctgctattaaatttagagatttacaatttccaagtaaagaattactt
caacttttagataaagaaaatgaagaatacaaacgactaaatgcaacgttcaaagaagat
cttacatttgctatattaaaaggagattcattagatccaatattacatccaaaatacctt
agtgatgaagataatcaaagaaaagaaaagttattaaaagaaaccttttatgattgggat
gataatgactttagaaaatggaaaacagccatgaagaaatatggttatgaaaaactagat
gaaattagtacatatatgggaaaagataaacaagaagttcaaagatacaataatgttttt
attcaaagatataatgaagtcaatgaaggagaaaaactatacaattcattatttaaaagt
gaacaaaaaagaaaattaagagaaaaagaacaagaagacttagcacaagctatcaaagct
aagcctgatgatatgacagtactaactccatacgtttattttggaaattctcaaactgat
ccattagtagattcaatgatgttaagaaaatatgcagaatatggagaagactgggaaagg
atcttaaaagaaatcaaagaacatccattatttgtgtttaatatctatattaactcatat
actccacaaactgttaaagagaaaatcagatttctaatacataatgtagaaaagactaaa
gaaaaaatgacaaaagaaaatgatggaaatattgtattagataaaatagagattaatgat
aattttgagaataaaaaaatgagaaaagaagatgataataatgattga

DBGET integrated database retrieval system