KEGG   Entamoeba histolytica: EHI_049540Help
Entry
EHI_049540        CDS       T00238                                 

Gene name
21.t00003
Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
ehi  Entamoeba histolytica
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 379 aa AA seqDB search
MSKYVGRLFSPRDDHVKKFFSNYPICGIRNLGNTCFISSVLQSLANTQQIRSYCFHHYNP
IKGRAGDKSVYHGSLLNAFINLTNAIWSGNYRFVTSLAIKDIVSETHPQYEGKDQNDAHE
FLLIFLEMLENELNTKDINNFSSSISPLLLTPIPCRGTIKTYSHENSPSKIYYSPFEVEM
NETESDDSSSDSYFSKNLISDVFKGRIKRVTECSMCHYSSDIFEEFISLSVPVPQWYSNE
AHPISLESCIELFLHYENIDDWYCEKCNKKRKAKIYSTISDIPKVLIIQLVRIYSKKYPI
QQVLFPLNDLVVQTSPNHFDFYDLYSFITHTGSLSKGHYISWNKVSNQWYCCNDENVSQG
NPTTSSDTVYILFYKRKVS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaatatgtgggaagattattctcccctcgtgatgaccatgtcaagaaattcttt
tcaaattatccaatttgtggaattagaaatttaggaaatacttgttttataagttcagtt
ttacaatctctagctaacacccaacaaattcggtcgtattgttttcatcactacaaccca
attaaaggaagagcaggagataagtcagtatatcatggctctcttctaaacgcatttatc
aatttaacaaatgccatctggtcaggaaactatagatttgtaacttctttagcaatcaaa
gacattgtatcagaaacacatccacagtatgaaggaaaggatcaaaatgatgcacatgaa
tttttattaatctttcttgaaatgttagaaaacgaattaaacacaaaagatataaataat
ttctcttcttctatttcaccactccttctcacaccaattccttgtagaggaacaataaag
acatattctcatgaaaattctccttcaaaaatatattattctccatttgaagttgaaatg
aatgagactgaatctgatgactcatcttcagactcttatttttcaaaaaatcttattagt
gatgtttttaaaggaagaattaaacgtgtaactgaatgttcaatgtgtcattatagctca
gatatttttgaggaatttatttctttatcagttccagtacctcaatggtattcaaatgaa
gcacatccaatctcattagagagttgtattgaattatttcttcactatgaaaatatagat
gattggtattgtgaaaaatgcaacaaaaaaagaaaggctaaaatatattcaactatcagt
gatattcctaaagttttaatcattcaattggttagaatatactcaaagaaatacccaatt
caacaagttttgtttcctttaaatgatttagtagttcaaacatcccctaaccatttcgac
ttttatgatttatattcttttatcactcatacaggatcattatcaaaaggtcattacata
tcatggaataaagtatcaaaccaatggtactgttgcaacgatgaaaatgtctctcaaggt
aaccctaccacatcatctgatactgtgtacattcttttttataaaaggaaagtaagttga

DBGET integrated database retrieval system