KEGG   Entamoeba histolytica: EHI_049540Help
Entry
EHI_049540        CDS       T00238                                 

Gene name
21.t00003
Definition
ubiquitin carboxyl-terminal hydrolase
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.4.19.12]
Organism
ehi  Entamoeba histolytica
Brite
Enzymes [BR:ehi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     EHI_049540 (21.t00003)
Peptidases [BR:ehi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   EHI_049540 (21.t00003)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 379 aa AA seqDB search
MSKYVGRLFSPRDDHVKKFFSNYPICGIRNLGNTCFISSVLQSLANTQQIRSYCFHHYNP
IKGRAGDKSVYHGSLLNAFINLTNAIWSGNYRFVTSLAIKDIVSETHPQYEGKDQNDAHE
FLLIFLEMLENELNTKDINNFSSSISPLLLTPIPCRGTIKTYSHENSPSKIYYSPFEVEM
NETESDDSSSDSYFSKNLISDVFKGRIKRVTECSMCHYSSDIFEEFISLSVPVPQWYSNE
AHPISLESCIELFLHYENIDDWYCEKCNKKRKAKIYSTISDIPKVLIIQLVRIYSKKYPI
QQVLFPLNDLVVQTSPNHFDFYDLYSFITHTGSLSKGHYISWNKVSNQWYCCNDENVSQG
NPTTSSDTVYILFYKRKVS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaatatgtgggaagattattctcccctcgtgatgaccatgtcaagaaattcttt
tcaaattatccaatttgtggaattagaaatttaggaaatacttgttttataagttcagtt
ttacaatctctagctaacacccaacaaattcggtcgtattgttttcatcactacaaccca
attaaaggaagagcaggagataagtcagtatatcatggctctcttctaaacgcatttatc
aatttaacaaatgccatctggtcaggaaactatagatttgtaacttctttagcaatcaaa
gacattgtatcagaaacacatccacagtatgaaggaaaggatcaaaatgatgcacatgaa
tttttattaatctttcttgaaatgttagaaaacgaattaaacacaaaagatataaataat
ttctcttcttctatttcaccactccttctcacaccaattccttgtagaggaacaataaag
acatattctcatgaaaattctccttcaaaaatatattattctccatttgaagttgaaatg
aatgagactgaatctgatgactcatcttcagactcttatttttcaaaaaatcttattagt
gatgtttttaaaggaagaattaaacgtgtaactgaatgttcaatgtgtcattatagctca
gatatttttgaggaatttatttctttatcagttccagtacctcaatggtattcaaatgaa
gcacatccaatctcattagagagttgtattgaattatttcttcactatgaaaatatagat
gattggtattgtgaaaaatgcaacaaaaaaagaaaggctaaaatatattcaactatcagt
gatattcctaaagttttaatcattcaattggttagaatatactcaaagaaatacccaatt
caacaagttttgtttcctttaaatgatttagtagttcaaacatcccctaaccatttcgac
ttttatgatttatattcttttatcactcatacaggatcattatcaaaaggtcattacata
tcatggaataaagtatcaaaccaatggtactgttgcaacgatgaaaatgtctctcaaggt
aaccctaccacatcatctgatactgtgtacattcttttttataaaaggaaagtaagttga

DBGET integrated database retrieval system