KEGG   Entamoeba histolytica: EHI_049700Help
Entry
EHI_049700        CDS       T00238                                 

Definition
beta-amylase
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
ehi  Entamoeba histolytica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EHI_049700
Enzymes [BR:ehi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.2  beta-amylase
     EHI_049700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 437 aa AA seqDB search
MIFFLSVVTLALATEVNLMMPLDTVNSNGVNNKGQLQNDLNKIKSGGVAGVMADVWWGLV
ETSPRNYNWNGYKELVQMVKKAGLKFQAVMSFHKCGGNVGDSVTIEIPQWVRNAGAANDA
FFKDNENNVNNEYISFAYDDSSIFEGRTPIEIYKDFMTSFKQNFQSYIDDGTINEIQVGM
GPCGETRYPSYPLSRWSYCGVGEFQCNDGKSKELLKKAATDKGHSEWGNGSPSNAGNYNS
KPPSSTGFFGNGFDNYQSEYGRFFQEWYFDLLLSHTDKVLSAARNVFGNTLALAGKISGV
HWWYNDQSHAAEMTAGYYNSNGNDAYKTLSNTFKNNNVRFDFTCLEMSGTDGNCGSSPAN
LVDQAFNAAGTVGIGKCGENALELCGYGGCNTNGFNQIINKCKQHGLTAFTYLRMTRGLL
DDGNAWGQFTNFVSRMK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgatattcttcttaagtgtagttactttggctttagcaactgaagtcaatttgatgatg
ccacttgatacagtcaattccaatggagttaataataaaggacaacttcaaaatgactta
aataaaattaaatcaggaggagttgctggtgttatggcagatgtttggtggggacttgta
gaaacatcaccaagaaattacaattggaatggatataaagaattagttcaaatggttaaa
aaagcaggattaaaattccaagcagttatgtcattccataaatgtggaggaaatgtagga
gattcagtaacaattgaaattccccaatgggtaagaaatgcaggagcagcaaatgatgcg
ttctttaaagacaatgaaaataatgttaataatgaatatatttcatttgcatatgatgat
tcatctatttttgaaggaagaacaccaattgaaatttataaagactttatgacatcattt
aaacaaaacttccaaagttatattgatgatggaacaattaatgaaattcaagttggtatg
ggaccatgtggagaaactagatatccatcatatccactttcaaggtggagttattgtgga
gtaggagagttccaatgtaatgatggtaagtcaaaagaattacttaaaaaagcagcaaca
gataaaggacattcagaatggggaaatggatcaccatcaaatgcaggaaattataattct
aaaccaccctcatcaacaggattctttggaaatggatttgataactaccaaagtgaatat
ggacgattcttccaagaatggtattttgacttgttattaagtcatacagataaagttctt
tcagcagcaagaaatgtatttggaaatacacttgcacttgcaggtaaaatatcaggagtt
cattggtggtataatgaccaatcacatgcagctgaaatgacagctggatattacaactca
aatggaaatgatgcatacaaaacactttctaatacattcaaaaataataatgttagattt
gactttacctgtcttgaaatgagtggaactgatggaaattgtgggtcatcaccagctaat
ttagttgatcaagcatttaatgcagcaggaacagttggaattggcaaatgtggagaaaac
gcacttgaattatgtggatatggaggatgtaatactaatggatttaatcaaatcatcaat
aaatgtaaacaacatggattaacagcattcacatacttgagaatgacaagaggacttctt
gatgatggaaatgcatggggacaattcactaattttgttagtagaatgaaataa

DBGET integrated database retrieval system