KEGG   Entamoeba histolytica: EHI_049940Help
Entry
EHI_049940        CDS       T00238                                 

Gene name
12.t00002
Definition
ubiquitin carboxyl-terminal hydrolase 5 (EC:3.1.2.15)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
ehi  Entamoeba histolytica
Brite
Enzymes [BR:ehi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     EHI_049940 (12.t00002)
Peptidases [BR:ehi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   EHI_049940 (12.t00002)
Exosome [BR:ehi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   EHI_049940 (12.t00002)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 708 aa AA seqDB search
MNLFVVPSTYPEIHKTDCMYCPVSIGTQNNDKLYICLMDGQSFCEECLHIHQEVSGHQLY
LVIHEIQEKEEDDFFKEKKKEYWIEKEEENKERINIESLEEGKIKDYIKYIIGSIGVEKK
VCESENNRTRIYTENIQQIARSKKLDLNNIQCEEEGCDVKDNLWLNLIDGSVYCGREQMM
VKGHSHALKHYEKTKRPLVVKIGTISSDGTADMYDYNTDEDVRDPLLKEHLGFYGIDISK
LSKTQLSLDEIAKEAALKMERDRIEEIGIEHKICYGPYKTGIRNSGNTCYAASGVQLIFG
ISEVRNKLKQEYQQLIRKNWKGIEYHMTTQMAKLAQGFVSGKCSEEEDNTGSQVGMSIIG
LKQGLGHYYQMYKTNEQQDSSEFVLHLIDRMEQEGFKEIQENLEVVIRNEIKGEGMSVNT
TREKIIEMGLDVPYMVLIERKHIDLHMEDIIKMYGSVTPIEGYQKNGRYINATKRIRIGK
FPKYLLIKLERQIALSYEDVRKVDADVFGMERIDLSMLKSNNKEEEKEEKVEINQEKLEV
LSSMGFDEIQAKTALRITNNDIEEAIMKLTSGEIKEIEDTITDKYREGIVMMKDMGFDEE
SSRKALEKTKGDIEQAIIFAATCNEEKENKMEEEKENKMEEEGNDDDRSGKYELIGFVSH
IGANVNCGHYVCHMKQGDEWIMFNDNKVYQSQNPPFTRGYLYLYKSIE
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgaatttattcgttgttccttcaacatatcctgaaatccataaaacagattgtatgtat
tgtcctgtatctattgggacgcaaaataatgacaaattatatatttgtttaatggatgga
caaagtttttgtgaagaatgtcttcatattcatcaagaagttagtggacatcaactatat
ctagtcattcatgaaatacaagaaaaggaagaagacgatttctttaaagaaaagaaaaaa
gagtattggattgaaaaagaagaagaaaataaagaaagaatcaatatagaaagtcttgaa
gaaggaaaaataaaagattatattaaatatattattggaagtataggagttgaaaaaaaa
gtttgtgagagtgaaaataatagaacaagaatatacacagaaaatattcaacaaattgca
agaagtaaaaagttagacttaaataatattcaatgtgaagaagaaggatgtgatgttaaa
gacaatctttggttaaatttaattgatggaagtgtatattgtggaagagaacaaatgatg
gttaaaggacattcacatgcattaaaacattatgaaaagacaaaaagaccgttagttgta
aagataggaacaattagtagtgatgggacagcagatatgtatgactataatacggatgaa
gatgttagagatccattattaaaagaacatttaggattttatggaatagatattagtaag
ttaagtaagacacaactaagtttagatgaaattgcaaaagaagcagcattaaagatggaa
agagatagaattgaagaaatagggatagaacataaaatatgttatggaccatacaaaaca
gggattagaaatagtggaaatacatgttatgcagcatcaggtgttcaattaatctttgga
attagtgaagtaagaaataaattgaaacaagaatatcaacaattaattagaaagaattgg
aaaggaattgaatatcatatgacaactcaaatggctaaattagcacaaggatttgtttca
ggaaaatgttcagaagaagaagacaatactggaagtcaagttggaatgagtattattgga
ttaaaacaaggattaggtcattattatcagatgtataaaacaaatgaacaacaagacagt
agtgaatttgttcttcatttaattgataggatggaacaagaaggatttaaagaaattcaa
gaaaatttagaagtagtaatacgaaatgaaattaaaggagaaggaatgagtgttaataca
actagagaaaaaataatagaaatgggacttgatgttccatatatggttttaatagaaaga
aaacatattgatttacatatggaagatattattaaaatgtatggaagtgtaacaccaatt
gaagggtatcaaaagaatggaagatatattaatgcaactaaaagaataagaattggaaaa
tttccaaaatatcttcttattaaattagaaagacaaattgcattaagttatgaagatgta
agaaaagtagatgcagatgtttttggaatggagcgtattgatttatcaatgttaaaaagt
aataataaagaagaagaaaaggaagaaaaagttgaaattaatcaagaaaaattagaggtt
ctaagttcaatgggatttgatgaaatacaagcaaaaacagcattaagaataacaaataat
gatatagaagaagcaataatgaagttaactagtggagaaattaaagaaatagaagataca
ataacagataaatatagagaaggaatagtcatgatgaaagacatgggatttgatgaagaa
agcagtcgaaaagcacttgagaaaacaaaaggtgatattgaacaagctattatatttgca
gcaacatgtaatgaagaaaaagaaaataagatggaagaagaaaaagaaaataagatggaa
gaagaagggaatgatgatgatagaagtggaaaatatgaacttattggatttgtgtcacat
attggagcaaatgttaattgtggacattatgtatgtcatatgaaacaaggggatgaatgg
attatgtttaatgacaataaagtttatcaatcacaaaacccaccatttactcgaggatat
ctctatctctataagtcaatagaataa

DBGET integrated database retrieval system