KEGG   Entamoeba histolytica: EHI_053040Help
Entry
EHI_053040        CDS       T00238                                 

Gene name
4.t00093
Definition
protein kinase
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ehi  Entamoeba histolytica
Pathway
Amoebiasis
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    EHI_053040 (4.t00093)
Enzymes [BR:ehi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     EHI_053040 (4.t00093)
Protein kinases [BR:ehi01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   EHI_053040 (4.t00093)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 434 aa AA seqDB search
MSVKTGWGIKEGGSWKTWKRRMFKLSEGKIEYFKDEGMTKKMGDIELSKVTHVLAVDQYK
KRKNLIRIITPSRTYHISVNEESDRDSWVEAIRGMIGDNKEKKTQEEKEENKISMEDFDI
ITLLGKGAFGKVMLVKYKKEGKIYAMKTVEKAQIIDSNEVEHILSEKVVLSQINNPFLVN
MHYSFQTPTHLVFILDYCAGGELFSYLQKHPAGLPEVDVKFYAAQIVLALEHMHSTGIIY
RDIKPENILFEKDGYLRMTDFGLAKSTKKGTTNTFCGTPEYLAPEVVEGLDYNEYIDWWG
LGILIYEMLFTQSPFLAETMEELYENILQREPKYPSTKPITEECMNFINSLLIKEPSKRL
TDPDQIKTHPWFNGFNFDDLYKKKLTPPYVPKIQSQTDTSNFDDEITQEEVDLKTGVEVV
ADNRFFTDFTYVQK
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttaaaacaggatggggaataaaagaaggaggtagttggaaaacatggaaaaga
agaatgtttaaactaagtgaagggaaaatagaatattttaaagatgaagggatgacaaaa
aaaatgggagatattgaattaagtaaagtcacacatgtacttgcagtagaccaatataaa
aaaagaaaaaatctaataagaattattacaccatcaagaacatatcatattagtgtcaat
gaagaaagtgatagagactcatgggtagaagcaataagaggaatgattggagataacaaa
gagaagaagacacaagaagaaaaagaagaaaataaaataagtatggaagattttgatatt
ataacattattagggaaaggagcatttggaaaagttatgttagttaaatataaaaaagaa
ggaaaaatatatgcaatgaaaacagttgaaaaagcacaaataattgatagtaatgaagta
gaacatatattatccgaaaaagtagtattatcacaaattaataatccatttcttgttaat
atgcattattcatttcaaacaccaacacatcttgtatttattttagattattgtgcagga
ggagaattatttagttatttacaaaaacatccagcaggattaccagaagtagatgtaaaa
ttttatgcagcacaaatagtattagcattagaacatatgcatagtacaggaattatttat
cgagatattaaaccagaaaatattctttttgaaaaagatggatatttacgaatgacagat
tttggattagcaaaaagtacaaaaaaaggtactacaaacacattttgtggaacaccagaa
tatcttgcaccagaagtagttgaaggattagattataatgaatatattgattggtgggga
ttaggtattttaatatatgaaatgttatttacacaatcaccgtttttagctgaaacaatg
gaagaattatatgaaaatattttacaaagagaaccaaaatatccatcaacaaaaccaatc
acagaagaatgtatgaattttattaatagtttattaattaaagaaccatctaaaagacta
actgatcctgatcaaattaaaacacatccatggtttaatggatttaattttgatgactta
tataagaaaaaattaacaccaccatatgttccaaaaattcaatcacaaactgatacatca
aattttgatgatgaaattacacaagaagaagttgatttaaaaacaggagttgaggttgtt
gctgacaatagattttttacagattttacttacgtacaaaaataa

DBGET integrated database retrieval system