KEGG   Entamoeba histolytica: EHI_056480Help
Entry
EHI_056480        CDS       T00238                                 

Gene name
202.t00008
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ehi  Entamoeba histolytica
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ehi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EHI_056480 (202.t00008)
   01230 Biosynthesis of amino acids
    EHI_056480 (202.t00008)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EHI_056480 (202.t00008)
   00051 Fructose and mannose metabolism
    EHI_056480 (202.t00008)
   00562 Inositol phosphate metabolism
    EHI_056480 (202.t00008)
Enzymes [BR:ehi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EHI_056480 (202.t00008)
Exosome [BR:ehi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EHI_056480 (202.t00008)
  Exosomal proteins of bladder cancer cells
   EHI_056480 (202.t00008)
  Exosomal proteins of melanoma cells
   EHI_056480 (202.t00008)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
AA seq 261 aa AA seqDB search
MSARKFVVGGNWKCNGTLASIETLTKGVAASVDAELAKKVEVIVGVPFIYIPKVQQILAG
EANGANILVSAENAWTKSGAYTGEVHVGMLVDCQVPYVILGHSERRQIFHESNEQVAEKV
KVAIDAGLKVIACIGETEAQRIANQTEEVVAAQLKAINNAISKEAWKNIILAYEPVWAIG
TGKTATPDQAQEVHQYIRKWMTENISKEVAEATRIQYGGSVNPANCNELAKKADIDGFLV
GGASLDAAKFKTIINSVSEKF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctcgtaaatttgtcgttggtggaaattggaaatgtaatggtactcttgctagt
attgaaactttaactaaaggagttgctgcttcagttgatgctgaacttgctaagaaagtt
gaagttattgttggagttccatttatttatattccaaaagttcaacaaattcttgcagga
gaagctaatggtgctaatatactcgtttctgcagaaaatgcatggactaaatcaggagca
tatactggagaagttcatgttggaatgttagttgattgccaagttccatatgttattctt
ggacattctgaaagaagacaaattttccatgaaagtaatgaacaagttgctgaaaaagtt
aaagttgctattgatgctggattaaaagtcattgcctgtattggcgaaactgaagcacaa
agaattgctaatcaaactgaagaagttgttgcagcacaacttaaagctattaataatgct
atttcaaaagaagcatggaagaatattattcttgcatatgaaccagtctgggctattgga
actggtaagactgctactccagatcaagctcaagaagttcatcaatacatcagaaagtgg
atgactgaaaatatttctaaagaagttgctgaagctacaagaattcaatatggtggatct
gttaatccagctaactgtaatgaacttgctaagaaagctgacattgatggtttcttagtt
ggaggagcttcattagatgctgctaaattcaagactatcattaactcagtttctgagaaa
ttctaa

DBGET integrated database retrieval system