KEGG   Entamoeba histolytica: EHI_068390Help
Entry
EHI_068390        CDS       T00238                                 

Gene name
61.t00017
Definition
thioredoxin
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
ehi  Entamoeba histolytica
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 244 aa AA seqDB search
MLLFFIPFILFFSLSSAYIWEFDPNKLQRQLTQNKTVLLLHYIPYGETYKNYKSTFSQLD
EAIQKQQNKNIIVGQIDCEEYEDYCENNQITHYPSFTILQPNDQTIFINSLETKKIQEAL
HTIGIEIEDIKPIHIITFTFENSTEIAKEPTLVKFFVPWCGHCNSLKPIWENISRESKLR
IGEVNCDKESRLCSIYSISHYPTIIYITKDQNNNEVREVYEGERTFKDLKTFIEQKNNSK
KQEL
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgttactctttttcattccttttattttatttttctctttatcatctgcttatatctgg
gaatttgatccaaataaactacaacgccaattaactcaaaacaaaactgtcttattatta
cattatatcccttatggagaaacatataaaaattataaaagtacatttagtcaactcgac
gaagcaatacaaaaacaacaaaataaaaatattattgttggtcaaatagactgtgaagaa
tatgaagactattgtgaaaataatcaaataactcattatccttcattcactattcttcaa
ccaaatgatcaaacaatttttattaattctcttgaaacaaaaaaaatacaagaagcatta
catacaattggtattgaaattgaagatattaaaccaattcatatcatcactttcactttt
gaaaattctactgaaatagcaaaagaaccaactcttgtaaaattctttgttccatggtgt
ggtcattgtaatagcttaaaaccaatttgggaaaatatttcacgagagtctaaactcaga
attggtgaggtaaattgtgacaaagaatctcgattatgttctatttattcaatttcacac
tatccaacaattatctatatcacaaaagatcaaaataataatgaagttagagaagtttat
gaaggagaaagaacatttaaagacttaaaaacatttattgaacagaaaaataattcaaag
aaacaagaactttaa

DBGET integrated database retrieval system