KEGG   Entamoeba histolytica: EHI_071320Help
Entry
EHI_071320        CDS       T00238                                 

Definition
protein kinase domain containing protein
Orthology
K08850  
aurora kinase, other [EC:2.7.11.1]
Organism
ehi  Entamoeba histolytica
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 295 aa AA seqDB search
MAAPRRVEQLSVNSPLKKEIESKPKKDDEKKPTQLSLDMFDIGKPLGQGKFGNVYLVKYK
KYNYVCALKVIFKRQLQQYRMGIQMKREIELQSHLNHPNILKLFGLFEDKNRWFLVLEYC
KKGELYGLLQQAGRFDERRAARYIKATTEALKYCQEMNCIYCDLKPENIMIDHNDQVKLA
DFGWSVHTNTKRNTYCGALDYLCPEIVLEKYYDGSIGQWCLGVLTFELCTGEPPFQSNSR
EEVMKKVRHVKYSFPSYLTNDCKDFINKLIQYDPSKRMSFAECLVHPWIIKNTTN
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcctcgtagggttgaacaattatcagtaaattctcctcttaaaaaagaaatt
gaaagtaaaccaaaaaaagatgatgaaaaaaagccaacccaattgtcgttggatatgttt
gatattggaaaaccacttggtcaaggaaaatttggaaatgtttatcttgtaaaatacaaa
aaatataattatgtttgtgcattaaaagttatatttaaaagacaattacaacaataccgg
atgggaattcaaatgaaaagagagattgaattacaatctcatcttaatcatcctaatatt
ctcaaattattcggactttttgaagataaaaacaggtggttccttgttcttgaatattgt
aagaaaggtgaattatatgggttattacaacaagctggtcgttttgatgaaagaagagct
gctcgatacataaaagcaacaactgaagctttaaagtattgtcaagagatgaattgtatt
tattgtgatttaaaaccagaaaacatcatgatagatcacaatgatcaagtcaaattagct
gactttggatggtctgttcatactaatactaaaagaaatacttattgtggtgcattagat
tatttatgtcctgaaattgtattagaaaaatattatgatggatcgattggtcaatggtgt
ttaggagttttaacatttgaactatgtactggtgaacctccatttcaatctaacagtcgt
gaagaggttatgaaaaaagtcagacatgttaaatattcttttccaagctatctcacaaat
gattgcaaagattttattaacaaactaattcaatatgatccttctaaaagaatgagtttt
gctgagtgtttagttcatccatggataatcaaaaacacaacaaattga

DBGET integrated database retrieval system