KEGG   Entamoeba histolytica: EHI_071590Help
Entry
EHI_071590        CDS       T00238                                 

Gene name
206.t00013
Definition
protein disulfide isomerase
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ehi  Entamoeba histolytica
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:ehi04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 368 aa AA seqDB search
MLLKTNQKISSVNVEHCQNTDKRELMKYKVLMKFLLFTLLTFLVSADVVSLNPTNFNTIV
DGSKHVFVKFFAPWCGHCKKLAPEYIKLADAYKDKQDIVIAELDCDNKDHKDLCGKFGIS
GFPTLKFFRKGTTEPIEYEGGRTVEDLSHFIQEKIQPKAPSNVVSVTTATFDSIVMDPTK
NVFVKFFAPWCGHCKALAPKYIEVSKMYAGEDDLVVAEVDCTANQETCNKYEVHGYPTLK
SFPKGENKKPIAYEGGREVKDFVTYFNTNYGYDRDENGKLGKTAGRIAELDDLAKGFANK
ENKDEIIKKAEAIEGGAYYVKVMKRIIERGADYVEKEKARINKILENPSMKAKKIDDFTR
NLNVLEVF
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgttattaaaaacaaatcagaagattagttctgtcaacgtggaacattgtcagaacact
gataaaagagaactgatgaaatataaagtattaatgaaattccttcttttcactttactt
acttttttagtatctgctgatgtagtatcattaaatccaacaaacttcaatactattgtt
gatggaagtaaacatgtttttgttaagttctttgctccatggtgtggacattgcaaaaaa
cttgctccagaatatattaaacttgctgatgcttacaaagataaacaagacattgtaatt
gctgaacttgattgtgacaataaagaccacaaagacctctgtggaaagtttggaattagt
ggatttccaaccttaaaattcttcagaaaaggaactactgaaccaattgaatatgaaggt
ggaagaactgtagaagatctttctcattttattcaagaaaagattcaacctaaagcacca
tctaatgttgtttcagtaacaactgctacatttgatagtattgtaatggacccaactaaa
aatgtctttgttaaattctttgctccatggtgtggacattgtaaggctctcgcaccaaaa
tatattgaagttagcaagatgtatgccggtgaagatgaccttgttgtagctgaagtcgat
tgtactgcaaatcaagagacatgtaacaaatatgaagtacatggatatcctactttaaaa
tcattcccaaagggagaaaataagaaacctattgcttatgaaggaggaagagaagttaaa
gactttgttacctacttcaataccaattatggatatgatagagatgagaatggaaaatta
ggtaaaactgctggaagaattgctgaacttgatgaccttgctaaaggatttgctaataaa
gaaaataaagatgaaattataaaaaaagctgaggcaattgaaggaggagcttattacgtt
aaagtcatgaaaagaattattgagagaggagcagattatgtagaaaaagaaaaggctaga
atcaataaaatcttagaaaacccatctatgaaagccaagaaaattgatgattttactaga
aacttgaatgtacttgaagttttctaa

DBGET integrated database retrieval system