KEGG   Entamoeba histolytica: EHI_073570Help
Entry
EHI_073570        CDS       T00238                                 

Gene name
67.t00013
Definition
histone acetyltransferase
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
ehi  Entamoeba histolytica
Brite
Enzymes [BR:ehi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     EHI_073570 (67.t00013)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 405 aa AA seqDB search
MDKELLNEVLAEVMEDPNLMDKDPLANKNKDFICSAQDAIGLYFVSNKEEVEKALKDKYL
ENAVDYPDYVHQLFMGDCEIYGYKDLKVHVLISVYSHQMYVDFSYSQKIDDAEDIIKCLH
KFMPKNQRILSLEGFIEQLEKEKYGFKPCGKKLYEFEQNGEVYEIYYGDVNTMYEYYCQL
FPVITMYIERANCVNPEGKWEFFNLFQVIENPSNVSQIEYRIAAQTNTYRFYHYPDSWRL
RIGQFITFPNYQRKKLGRYLLRQVYSFILSDKDFDLTVEDACLEFQKLRTFVELKMMEEQ
QLKLPIDIQSDTLSECPEDFCEIVRKKCGITKMEIMSLYEMMVWAELKNNNEIMPKLALE
LKRKYYSQTKTELELLESDEMRLEMIERAYKAKIAHFKQIYNVLE
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggataaagaattactcaatgaagtattagccgaagtaatggaagatcctaatttaatg
gacaaagatccacttgcaaataaaaataaagattttatatgttcagcacaagatgcaata
ggattatattttgtgtctaataaagaagaagtagaaaaagcacttaaagataaatattta
gagaatgcagttgattatcctgattatgttcaccaattatttatgggagattgtgaaata
tatgggtataaagatttaaaggttcatgtattgattagtgtctattcacatcaaatgtat
gttgacttttcatattcacaaaaaatagatgatgcagaagatataattaaatgtcttcat
aaatttatgccaaaaaatcaaagaattttatcattagaaggttttattgaacaattagaa
aaagaaaaatatggatttaaaccttgtggaaagaaattatatgaatttgaacaaaatgga
gaggtttatgaaatttattatggagatgttaatactatgtatgaatattattgtcaatta
tttcctgttattacaatgtatattgaacgagccaattgtgttaatccagagggaaaatgg
gaattttttaatttgtttcaagttattgaaaatccatcaaatgttagtcaaattgaatat
aggatagctgcacaaacaaatacatataggttttatcattatccagattcatggagatta
cgtattggacaatttataacatttcctaattatcaaagaaaaaagttaggaagatattta
ttaagacaagtatattcattcattttatcagataaagattttgatttaactgttgaagat
gcatgtttagaatttcaaaaattaagaacatttgtagaacttaaaatgatggaagaacaa
caattaaaattaccaattgatattcaatcagatacgttaagtgaatgtccagaagatttt
tgtgagatagttagaaaaaaatgtggaataacaaaaatggaaataatgtcattatatgaa
atgatggtatgggcagaattaaaaaataataatgaaataatgcctaagttagcattagaa
ttaaaaagaaaatattactcacaaacgaaaacagaacttgaattattagaaagtgatgaa
atgagattagaaatgattgaaagagcatataaagcaaaaattgctcattttaaacaaatt
tataatgttttagaataa

DBGET integrated database retrieval system