KEGG   Entamoeba histolytica: EHI_073650Help
Entry
EHI_073650        CDS       T00238                                 

Gene name
67.t00005
Definition
mitogen-activated protein kinase (EC:2.7.11.24)
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
ehi  Entamoeba histolytica
Brite
Enzymes [BR:ehi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     EHI_073650 (67.t00005)
Protein kinases [BR:ehi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   EHI_073650 (67.t00005)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 352 aa AA seqDB search
MSDKEYMSSCDPDEELDLKIAKKYDIVQKIGKGAYGVVWKAVDKTTHETVALKKIFDAFQ
NATDAQRTFREIMYLQRMDHENIVQLVNVMKAENNKDIYLAFEYMETDLHAVIRANILED
IQIRYIIYQLLKALKYLHSAGIVHRDIKPSNLLLNSDCLLKVADFGLARSLDKETLQTDY
VETRWYRAPEILLGSQRYSFAIDLWSVGCILGEIINGKPLFPGSSTLNQLDKIIEATGQP
SAEDLEVIDSPLSMNLLSSLPQRETKGLAEIVPKASDDALELMEELLTFNPEKRATAEKA
LESTFVADFHDPNDEPSAPGKITIPITDNHKYSINNYRGSLYVEIMRKYPQN
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgagtgataaagagtatatgagcagttgtgatccagacgaagaattagatttaaaaatt
gcaaagaaatatgatattgtacaaaaaataggtaaaggggcatatggagttgtttggaaa
gctgtagataaaactactcatgaaactgttgctttaaaaaaaatatttgatgcattccaa
aatgccacagacgctcaaagaacatttagagaaattatgtatttacaacgaatggatcat
gaaaatatagttcaattagtaaatgtaatgaaagcagaaaataataaagatatttattta
gcctttgaatatatggaaactgaccttcatgcagttattagagctaatatattagaagat
attcaaattcgatacattatttatcagttattaaaagccttaaaataccttcatagtgct
ggaattgttcatagagatattaaaccatctaatttgttacttaattctgactgtcttctt
aaagttgctgattttggattagctcgttctcttgataaagaaactcttcaaacagattac
gttgaaacccgatggtatagagctccagaaattttattaggttcacaacgttattctttt
gcaattgatctttggagtgtagggtgtattttaggtgaaattattaatggtaaaccttta
ttccctggaagttctacattaaatcaattagataaaattattgaagctactggtcaacct
tcagctgaagatcttgaagttattgattctccactttcaatgaatcttttatcaagtctt
ccacaacgtgaaacaaaagggttagcagagattgttccaaaagcttcagacgatgcttta
gaattaatggaagaattattaacatttaatcctgaaaaacgtgcaacagcagaaaaagct
cttgaatctacatttgttgctgattttcatgacccaaatgatgaaccatcagcaccaggt
aaaattacaattccaattactgataatcataagtattcaatcaataattaccgtggttca
ttatatgttgaaataatgagaaaatatccacaaaattaa

DBGET integrated database retrieval system